KEGG   Macaca mulatta (rhesus monkey): 702488Help
Entry
702488            CDS       T01028                                 

Definition
cytochrome c-like
Orthology
K08738  
cytochrome c
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Sulfur metabolism
Metabolic pathways
p53 signaling pathway
Apoptosis
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Amyotrophic lateral sclerosis (ALS)
Huntington's disease
Legionellosis
Toxoplasmosis
Tuberculosis
Hepatitis B
Influenza A
Herpes simplex infection
Pathways in cancer
Colorectal cancer
Small cell lung cancer
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    702488
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    702488
   04115 p53 signaling pathway
    702488
 Human Diseases
  Cancers
   05200 Pathways in cancer
    702488
   05210 Colorectal cancer
    702488
   05222 Small cell lung cancer
    702488
  Neurodegenerative diseases
   05010 Alzheimer's disease
    702488
   05012 Parkinson's disease
    702488
   05014 Amyotrophic lateral sclerosis (ALS)
    702488
   05016 Huntington's disease
    702488
  Cardiovascular diseases
   05416 Viral myocarditis
    702488
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    702488
  Infectious diseases
   05134 Legionellosis
    702488
   05152 Tuberculosis
    702488
   05164 Influenza A
    702488
   05161 Hepatitis B
    702488
   05168 Herpes simplex infection
    702488
   05145 Toxoplasmosis
    702488
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
20
AA seq 102 aa AA seqDB search
MGAVEKGKKIFVQKCAQCHTIEKGGKHKTGPNLFGRKTGQAVGFSHTDASKNKGITWGED
ALMQYLKNPKKYISGTKMIFAGIKKEAERADLRAYLKKATNE
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctgttgagaaaggcaagaagatttttgttcagaagtgtgcccagtgccacacc
atagaaaagggaggcaagcataagactgggcctaatctcttcgggcggaagacaggtcag
gccgttggattctctcacacagacgccagtaagaacaaaggcatcacctggggagaggat
gcactgatgcagtatttgaagaatcccaagaagtacatctctggaacaaaaatgatcttt
gccggcattaagaaggaggcagaaagggcagacttgagagcttatctcaaaaaagctact
aatgagtaa

DBGET integrated database retrieval system