KEGG   Macaca mulatta (rhesus monkey): 702619Help
Entry
702619            CDS       T01028                                 

Gene name
PLA2G15, LYPLA3
Definition
(RefSeq) phospholipase A2 group XV
  KO
K06129  lysophospholipase III [EC:3.1.1.5]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00564  Glycerophospholipid metabolism
mcc04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    702619 (PLA2G15)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    702619 (PLA2G15)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     702619 (PLA2G15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LCAT Abhydrolase_6 Abhydrolase_1 Hydrolase_4
Motif
Other DBs
NCBI-GeneID: 702619
NCBI-ProteinID: NP_001252747
Ensembl: ENSMMUG00000010147
UniProt: A0A1D5RAG6
Position
20
AA seq 412 aa AA seqDB search
MGLHLRPCRVGLLPDGLLFLLLLLMLLADPALPAGRHPPVVLVPGDLGNQLEAKLDKPTV
VHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGK
TFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREM
IEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVL
ASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYSYTWSPEKVFVQTPTTNYTLRDYRRFFQ
DIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGD
GTVNLKSALQCQAWQSLQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgggcctccacctccgcccctgccgtgtggggctgctcccggatggcctcctgttcctc
ttgctgctgctaatgctgctcgcagacccagcgctcccggccggacgtcaccccccagtg
gtgctggtccctggtgatttggggaaccagctggaagccaaactggataagccgacagtg
gtgcactacctctgctccaagaagaccgaaagctacttcacaatctggctgaacctggaa
ctgctgctgcctgtcatcattgactgctggattgacaatatcaggctggtttacaacaaa
acatccagggccacccagtttcctgatggtgtggatgtacgtgtccctggctttgggaag
accttctcactggagttcctggaccccagcaaaagcagcgtgggttcctatttccacacc
atggtggagagccttgtgggctggggctacacacggggtgaggatgtccgaggggctccc
tatgactggcgccgagccccaaatgaaaacgggccttacttcctggccctccgcgagatg
atcgaggagatgtaccagctgtatgggggccccgtggtgctggttgcccacagtatgggc
aacatgtacacgctctactttctgcagcggcagccgcaggcctggaaggacaagtatatc
cgggccttcgtgtcactgggtgcgccctgggggggcgtggccaagaccctgcgcgtcctg
gcttcaggagacaacaaccggatcccagtcatcgggcccctgaagatccgggagcagcag
cggtcagctgtctccaccagctggctgctgccctacagctacacgtggtcacctgagaag
gtgttcgtgcagacgcccacgaccaactacacactgcgggactaccgcaggttcttccag
gacatcggctttgaagacggctggctcatgcggcaggacacagaagggctggtggaagcc
acgatgccacctggcgtgcagctgcactgcctctatggcactggtgtccccacaccagac
tcgttctactatgagagcttccctgaccgtgaccctaaaatctgctttggtgacggcgat
ggtactgtgaacttgaagagtgccctgcagtgccaggcctggcagagcctccaggagcac
caagtgttgctacaggagctgccaggcagcgagcacatcgagatgctggccaacgccacc
accctggcctatctgaaacgtgtgctccttgggccctga

DBGET integrated database retrieval system