KEGG   Macaca mulatta (rhesus monkey): 702732Help
Entry
702732            CDS       T01028                                 

Gene name
FLNB
Definition
(RefSeq) filamin B, beta
  KO
K04437  
filamin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    702732 (FLNB)
 Cellular Processes
  Cellular community
   04510 Focal adhesion
    702732 (FLNB)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    702732 (FLNB)
  Infectious diseases
   05132 Salmonella infection
    702732 (FLNB)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     702732 (FLNB)
  Intermediate filaments
   Intermediate filament-binding proteins
    702732 (FLNB)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   702732 (FLNB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 2602 aa AA seqDB search
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMYRKYHQRPTFRQMQLENVSVALEFLDRESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPQKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
EEAQVTPDSDKNKTYSVEYLPKVTGLHKVTVLFAGQHISKSPFEVNVDKAQGDASKVTAK
GPGLEAVGNIANKPTYFDIYTAGAGVGDIGVEVEDPQGKNTVELLVEDKGNQVYRCVYKP
MQPGPHVVKVFFAGDTIPKSPFIVQVGEACNPNACRASGRGLQPKGVRIRETADFKVDTK
AAGSGELSVTVKGPKGLEELVKQKGFLDGVYAFEYYPSTPGRYSIAITWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGSLGFAIEGPSQAKIEYDDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGDYNPDLVRAYGPGLEKSGC
IVSNLAEFTVDPKDAGKAPLKIFAQDGEGQPIDIQMKSRMDGTYACSYTPVKAIKHTIAV
VWGGVNIPHSPFRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVG
IKCDARVLSEDEEDVDFDIIHNANDTFTVKYVPPAAGRYTIKVLFASQEIPASPFRVKVD
PSHDASKVKAEGPGLSKAGVENGKPTHFTVYTKGAGKAPLNVQFNSPLPGDAVKDLDVID
NYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKLNGLENRVEVGK
DQEFTVDTRGAGGQGKLDVTILSPSRKVVPCLVTPVTGRESSTAKFIPREEGLYAVDVTY
DGHPVPGSPYTVEASLPPDPTKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLEHGKVGEAGLLSVDCSEAGPGALGLEAVSDSGAKAEVSIQNNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTVDSRPLTQ
VGGDHIKAHIANPSGASTECFVTDNADGTYQVEYTPFEKGLHVVEVTYDDVPIPNSPFKV
AVTEGCQPSRVQAQGPGLKEAFTNKPNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYIPFAPGDYDVNITYGGAHIPGSPFRVPVKDVVDPSKVKIAGPGLGSGVRARVL
QSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYMVSVKYADE
EIPRSPFKVKVLPTYDASKVTASGPGLSSYGVPASLPVDFAIDARDAGEGLLAVQITDQE
GKPKRAIVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDDIPLSPYRIRATQTGDASKCLAT
GPGIASTVKTGEEVGFVVDAKTAGKGKVTCTVLTPDGTEAEADVIENEDGTYDIFYTAAK
PGTYVIYVRFGGVDIPNSPFTVMATDGEVTAVEEAPVNACPPGFRPWVTEEAYVPVSDMN
GLGFKPFDLVIPFAVRKGEITGEVHMPSGKTATPEIVDNKDGTVTVRYAPTEVGLHEMHI
KYMGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEG
PSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDSRRCSQVKL
GSAADFLLDISETDLSSLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK
NGNHVANSPVSIMVVQSEIGDARRAKVYGRGLSEGRTFEMSDFIVDTRDAGYGGISLAVE
GPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVKESIT
RTSRAPSVATVGSICDLNLKIPEINSSDMSAHVTSPSGRVTEAEIVPMGKNSHCVRFVPQ
EMGMHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGVPAEFSIWTRE
AGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPDSPYLVPV
IAPSDDARRLTVMSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEP
DKYAVRFIPHENGVHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGAGLEGGTTG
IQSEFFINTTRAGPGTLSVTIEGPSKVKMDCQETPEGYKVMYTPMAPGNYLIGVKYGGPN
HIVGSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKASSDASKVTSKGA
GLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGD
YVLAVKWGEEHIPGSPFHVTVP
NT seq 7809 nt NT seq  +upstreamnt  +downstreamnt
atgccggtaaccgagaaggatctggcggaggacgcgccttggaagaagatacagcagaac
actttcacacgctggtgcaatgagcacctcaagtgcgtgaacaaacgcatcggcaacctg
cagacggacctgagcgacgggctgcggctcatcgcgctgctcgaggtgctcagccagaag
cgcatgtaccgcaagtaccatcagcggcccacctttcgccagatgcagctcgagaatgtg
tccgtggcgctcgagttcctggaccgtgagagcatcaagctcgtgtccatcgatagcaaa
gccattgtggatgggaacctgaagctcatcttgggtctggtgtggacgctgatcctccac
tactccatctccatgcctgtgtgggaggatgaaggggatgatgatgccaagaagcagacg
ccaaagcagaggctgctggggtggattcagaacaagatcccctacttgcccatcaccaac
tttaaccagaactggcaagatggcaaagccctgggagccctggtagacagctgtgctcca
ggtctgtgcccagactgggaatcctgggaccctcagaagcctgtagataatgcacgagaa
gccatgcagcaggcagatgactggctgggtgtcccacaggtcatcactcctgaagaaatc
attcacccggatgtggacgagcactcggttatgacttacctgtcccagttccccaaagcc
aagctcaagccaggggctcctctcaaacccaaactcaacccgaagaaagccagggcctat
ggcagaggaatcgagcccactggaaacatggtgaagcagccagccaaattcactgtggac
accatcagcgccgggcaaggagacgtgatggtgtttgttgaggacccagaagggaacaaa
gaagaggcacaagtgacccctgacagcgacaagaacaagacatactctgtggagtatctg
cccaaggtcactgggctgcacaaagtcacagtcctctttgcaggacagcacatctccaag
agcccatttgaagtgaatgttgacaaggcccagggagacgccagtaaagtcactgcaaaa
ggtccagggttggaagctgtagggaacatcgccaataagcccacttactttgacatctac
acggcaggagctggtgtgggtgacattggtgtggaggtggaagatccccaggggaagaac
actgtggaattgctcgtggaagacaaaggaaaccaggtgtatcgatgtgtgtacaaaccc
atgcagcccggcccccacgtggtcaaggtcttctttgctggggacactattcctaagagt
cccttcattgtgcaggttggggaagcctgcaatccaaatgcctgccgggccagtggccga
ggcctgcaacccaagggcgtccgtatccgggagactgcagatttcaaggttgacaccaaa
gctgcaggaagtggggagctcagtgtaaccgtgaagggtcctaagggtctggaggagctg
gtgaagcagaaaggctttctggatggggtctacgcattcgagtattaccccagcaccccg
gggagatacagcattgccatcacatgggggggacaccacattccaaagagcccctttgaa
gttcaagttggccctgaagcaggtatgcagaaagtccgtgcttggggccctgggctccat
ggtgggattgtcgggcggtcggcagacttcgtggtggaatccattggctctgaagtgggg
tctctggggtttgccattgaaggcccctctcaggcaaagattgagtacgatgaccagaat
gatggatcatgtgacgtcaaatactggcccaaggagcctggcgaatatgctgttcacatc
atgtgtgacgacgaagacatcaaggatagcccgtacatggccttcatccacccagccacg
ggagactacaaccctgatctggttcgagcatatgggccaggtttggagaaatctgggtgc
attgtcagcaacctggccgagttcactgtggatcctaaggatgctggaaaagctccctta
aagatatttgctcaggatggggaaggccaacctattgacatccagatgaagagtcggatg
gacggcacatatgcttgctcatacactccggtgaaggccatcaagcataccattgctgtg
gtctggggaggcgtgaacatcccgcacagccccttcagggtcaacatcgggcaaggtagc
catcctcagaaggttaaagtgtttgggccaggagtggagagaagtggtctgaaggcaaat
gaacctacacacttcacagtggactgtactgaggctggggaaggtgatgtcagcgttggc
attaagtgtgatgcccgggtgttaagtgaagatgaggaagacgtggattttgacattatt
cacaatgccaatgatacgtttacagtcaaatatgtgcctcctgctgctgggcgatacact
atcaaagttctctttgcatctcaggaaatccccgccagccctttcagagtcaaagttgac
ccttcccacgatgccagcaaagtgaaggcagaaggcccagggctcagcaaagcaggtgtg
gaaaatgggaaaccgacccacttcactgtctacaccaagggggccgggaaagccccgctc
aacgtgcagttcaacagccctcttcctggcgatgcagtgaaggatttggatgtcatcgat
aactacgactactcccacaccgttaaatatacacccacccaacagggcaacatgcaggtt
ctggtgacttacgggggcgatcccatccctaaaagccctttcactgtgggtgttgctgca
ccgctggatctgagcaagataaaactcaatgggctggaaaacagggtggaagttgggaag
gatcaggagttcaccgttgataccaggggggcaggaggccaggggaagctggacgtgaca
atcctcagcccctctcggaaggttgtgccatgcctagtgacacctgtgacaggccgggag
agcagcacagccaagttcatccctcgggaggaggggctgtatgctgtagacgtgacctac
gatggacaccctgtgcccgggagcccctacacagtggaggcctcactgccaccagatccc
accaaggtgaaggcgcatggtcctggcctcgaaggtggtcttgtgggcaagcctgctgag
ttcaccatcgataccaaaggagctggtaccggaggtctgggcttaacggtggaaggtcca
tgcgaggccaaaatcgagtgctccgacaatggtgacgggacctgctcagtctcttacctt
cccacaaaacccggggagtacttcgtcaacatcctctttgaggaagtccacatacctggg
tctcccttcaaagccgacattgaaatgccctttgacccctctaaagtcgtggcatcgggg
ccaggtctcgagcatgggaaggtgggtgaagctgggctccttagcgtcgactgttcagaa
gcgggaccaggggccctgggcctggaagctgtctcagactcgggagcaaaagccgaagtc
agtattcagaacaacaaagatggcacctacgcggtgacctacgtgcccctgacggccggc
atgtacacactgaccatgaagtatggtggtgaactcgtaccacacttccctgcccgggtc
aaggtggagcctgccgtggacaccagcaggatcaaagtctttggaccagggatagaaggg
aaagatgtgttccgggaagccaccaccgactttacggttgactctcggccgctgacccag
gttgggggtgaccacatcaaggcccacattgccaacccctcaggggcctccaccgagtgc
tttgtcacagacaatgctgatgggacctaccaggtggaatacacaccctttgagaaaggt
ctccatgtagtggaggtgacatatgatgatgtgcctatcccaaacagtcccttcaaggtg
gctgtcactgaaggctgccaaccatctagggtacaagcccaaggacctggattgaaagag
gcctttaccaacaagcccaatgtcttcactgtggttaccagaggggcaggaattggtggg
cttggcatcactgttgagggaccatcagagtcgaagataaattgcagagacaacaaggat
ggcagctgcagtgctgagtacattcctttcgctccgggggattatgatgttaatatcaca
tatggaggagcccacatccctggcagccccttcagggttcctgtgaaggatgttgtggac
cccagcaaggtcaagattgccggccctgggctgggctcaggcgtccgagcccgtgtcctg
cagtccttcacagtggacagcagcaaggctggcctggctccgctggaagtgagggtcctg
ggcccacgaggcctggtggagccagtgaacgtggtggacaatggggatggcacacacaca
gtaacctacactccatctcaggagggaccttatatggtctcagttaaatatgctgatgaa
gagattcctcgcagtcccttcaaggtcaaggtccttcccacatatgatgccagcaaagtg
accgccagtggccccggccttagttcctatggtgtgcctgccagtctacctgtggacttt
gcaatcgatgcccgagatgccggggaaggcctgcttgctgttcagataacggaccaagaa
ggaaaacccaaaagagccattgtccatgacaataaagatggcacatatgctgtcacctac
atccccgacaagactgggcgctatatgattggggtcacctacgggggtgatgacatccca
ctttctccttatcgcatccgagccacacagacgggtgatgccagcaagtgcctggccacg
ggtcctggaatcgcctccactgtgaaaactggcgaagaagtaggctttgtggttgatgcc
aagactgccgggaaggggaaagtgacctgcacggttctgaccccagatggcactgaggcc
gaggccgatgtcatcgagaatgaagatggaacctatgacatcttctacacagctgccaag
ccaggcacatatgtgatctatgtgcgcttcggtggtgttgatattcctaacagccccttc
actgtcatggccacagatggggaagtcacagccgtggaggaggcaccggtaaatgcatgt
ccccctggattcaggccctgggtgaccgaagaggcctatgtcccagtgagtgacatgaat
ggcctgggatttaagccttttgacctggtcattccgtttgctgtcaggaaaggagaaatc
actggggaggtacacatgccttctgggaagacggccacacctgagattgtggacaacaag
gacggcacggtgactgttagatacgcccccactgaagttgggctccacgagatgcacatc
aaatacatgggcagccacatccctgagagcccactccagttctatgtgaactaccccaac
agtggaagcgtttctgcatatggtccaggcctcgtgtatggagtggccaacaaaactgcc
accttcaccatcgtcacagaggatgcaggagaaggtggtctggacttggctattgagggc
ccctcaaaagcagaaatcagctgcattgacaataaagatgggacatgcacagtgacctac
ctgcccactctgccaggcgactacagcattctggtcaagtacaatgacaagcacatccct
ggcagccccttcacagccaagatcacagatgacagcaggcggtgctcccaggtgaagttg
ggctcggccgctgacttcctgcttgacatcagtgagactgacctcagcagcctgacggcc
agcattaaggccccatctggccgagatgagccctgtctcctgaagaggctgcccaacaac
cacattggcatctccttcatcccccgggaagtgggtgaacacctggtcagcatcaagaaa
aatggcaaccacgtggccaacagccccgtgtccatcatggtggtccagtccgagatcggt
gacgcccgccgagccaaagtctatggccgcggcctgtcagaaggccggactttcgagatg
tctgacttcatcgtggacacaagggatgcaggttatggtggcatatccttggcagtggaa
ggccccagcaaagtagacatccagacagaggacctggaagatggcacctgcaaagtctcc
tacttccccactgtgcctggggtttatatcgtctccaccaaatttgctgatgagcacgtg
cctgggagcccatttaccgtgaagatcagcggtgagggaagagtcaaagagagcatcacc
cgcaccagtcgggccccatccgtggccactgtcgggagcatttgtgacctgaacctgaaa
atcccagaaatcaacagcagtgatatgtcggcccacgtcaccagcccctctggccgtgtg
actgaagcggagattgtacccatggggaagaactcgcactgcgtccggtttgtgccccag
gagatgggcatgcacacggtcagcgtcaagtaccgcgggcagcacgtcactggcagcccc
ttccagttcaccgtggggccacttggtgaaggaggtgcccacaaggtgcgggcaggaggc
cctggcctggagagaggagaagcgggagtcccagctgagttcagcatttggacccgggaa
gcaggtgctggaggcctctccatcgctgttgagggccccagtaaggctgagattacattc
gatgaccataaaaatgggtcgtgcggtgtgtcttatattgcccaagagcctggtaactac
gaggtgtccatcaagttcaatgatgagcacattccggacagcccctacctggtgccggtc
atcgcgccctctgacgacgcccgccgcctcactgttatgagccttcaggaatcgggatta
aaagttaaccagccagcatcctttgctataaggttgaatggcgcaaaaggcaagattgat
gcaaaggtgcacagcccctctggagccgtggaggagtgccacgtgtctgagctggagcca
gataagtatgctgttcgcttcatccctcatgagaatggtgttcacaccatcgatgtcaag
ttcaatgggagccacgtggttggaagccccttcaaagtgcgcgttggggagcccggacaa
gcggggaaccctgccctggtgtccgcctatggcgcaggactcgaagggggcaccacaggt
atccagtcggaattctttattaacaccacccgagcaggtccggggacactatccgtcacc
atcgaaggcccgtccaaggttaaaatggattgccaggaaacacctgaagggtacaaagtc
atgtacacccccatggctcctggtaactacctgatcggcgtcaaatacggtgggcccaac
cacattgtgggcagtcccttcaaggccaaggtgacaggccagcgtctggttagccccggc
tcagccaatgagacctcgtccatcctggtggagtcagtgaccaggtcttctacagagacc
tgctatagcgccattcccaaggcatcctcagacgccagcaaggtgacctctaagggggca
gggctctcgaaggcctttgtgggccagaagagttccttcctggtggactgcagcaaagct
ggctccaacatgctgctgatcggggtccatgggcccaccaccccctgcgaggaggtctct
atgaagcatgtaggcaaccagcaatacaacgtcacatatgtcgtcaaggagcggggcgat
tatgtgctggctgtgaagtggggggaggaacacatccctggcagcccttttcatgtcaca
gtgccttaa

DBGET integrated database retrieval system