KEGG   Macaca mulatta (rhesus monkey): 703015Help
Entry
703015            CDS       T01028                                 

Gene name
KAT7, MYST2
Definition
(RefSeq) K(lysine) acetyltransferase 7
  KO
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     703015 (KAT7)
Chromosome [BR:mcc03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    703015 (KAT7)
   HAT complexes
    HBO1 complex
     703015 (KAT7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
16
AA seq 611 aa AA seqDB search
MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQDSSPVR
NLQSFGTEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRETKNAAD
HDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYN
FNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVRAQSRDKQIEERMLSHRQ
DDNNRHATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEHRQTYGNTREPLLEN
LTSEYDLDLFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYA
RLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQN
LCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQ
YMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEIS
IKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDP
SCLKWTPPKGT
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgaaggaagaggaatgcaggcagtagttcagatggaactgaagattccgatttt
tctacagatctcgagcacacagacagttcagaaagtgatggcacatcccgacgatctgct
cgagtcacccgctcctcagccaggctaagccagagttctcaagattccagtcctgttcga
aatttgcagtcttttggcactgaggagcctgcttactctaccagaagagtgacccgtagt
cagcagcagcctaccccagtgacaccgaaaaaatacccccttcggcagactcgttcatct
ggctcagaaactgagcaagtggttgatttttcagatagagaaactaaaaatgcagctgat
catgatgagtcaccacctcgaactccaactggaaacgcaccttcttctgagtcagacata
gacatctccagccccaatgtgtctcacgatgagagcattgccaaggacatgtccctgaag
gactcaggcagtgatctctctcatcgccccaagcgccgtcgcttccatgaaagctacaac
ttcaatatgaagtgtcctacaccaggctgtaactctctaggacaccttacaggaaaacat
gagagacatttctccatctcaggatgcccactctatcataacctctcagctgacgaatgc
aaggtgagagcacagagccgggataagcagatagaagaaaggatgctgtctcacaggcaa
gatgacaacaacaggcatgcaaccaggcaccaggcaccaacggagaggcagcttcgatac
aaggaaaaagtggctgaactcaggaagaaaagaaattctggactgagcaaagaacagaaa
gagaaatacatggaacacagacagacctatgggaacacacgggaacctctcttagaaaac
ctgacaagtgagtatgacttggatcttttccgaagagcacaagcccgggcttcagaggat
ttggagaaattaaggctgcaaggccaaatcacagagggaagcaacatgattaaaacaatt
gcttttggccgctatgagcttgatacctggtaccattctccatatcctgaagaatatgca
cggctgggacgtctctatatgtgtgaattctgtttaaaatatatgaagagccaaacgata
ctccgccggcacatggccaaatgtgtgtggaaacacccacctggtgatgagatatatcgc
aaaggttcaatctctgtgtttgaagtggatggcaagaaaaacaagatctactgccaaaac
ctgtgcctgttggccaaactttttctggaccataagacattatattatgatgtggaaccc
ttcctgttctatgttatgacagaggcggacaacactggctgtcacctgattggatatttt
tccaaggaaaagaattcattcctcaactacaacgtatcctgtatccttaccatgcctcag
tacatgagacagggctatggcaagatgcttattgatttcagttatttgctttccaaagtc
gaagaaaaagttggctccccagaacgtccactctcagatctggggcttataagctatcgc
agttactggaaagaagtacttctccgctacctgcataatttccaaggcaaagagatttct
atcaaagaaatcagtcaggagacggctgtgaatcctgtagacattgtcagcactctacaa
gcccttcagatgctcaagtactggaagggaaaacacctcgttttaaagagacaggacctg
attgatgagtggatagccaaagaggccaaaaggtccaactccaataaaaccatggatccc
agctgcttaaaatggacccctcccaagggcacttaa

DBGET integrated database retrieval system