KEGG   Macaca mulatta (rhesus monkey): 703015Help
Entry
703015            CDS       T01028                                 

Definition
histone acetyltransferase MYST2-like
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
mcc  Macaca mulatta (rhesus monkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 505 aa AA seqDB search
MPRRKRNAGSSSDGTXXXXXXXXSSPVRNLQSFGTEEPAYSTRRVTRSQQQPTPVTPKKY
PLRQTRSSGSETEQVVDFSDRVFPPLTGHLTGKHERHFSISGCPLYHNLSADECKVRAQS
RDKQIEERMLSHRQDDNNRHATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEH
RQTYGNTREPLLENLTSEYDLDLFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYE
LDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISV
FEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNS
FLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEV
LLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIA
KEAKRSNSNKTMDPSCLKWTPPKGT
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgaaggaagaggaatgcaggcagtagttcagatggaacnnnnnnnnnnnnnnnn
nnnnnnnattccagtcctgttcgaaatttgcagtcttttggcactgaggagcctgcttac
tctaccagaagagtgacccgtagtcagcagcagcctaccccagtgacaccgaaaaaatac
ccccttcggcagactcgttcatctggctcagaaactgagcaagtggttgatttttcagat
agagttttccctcctttaacaggacaccttacaggaaaacatgagagacatttctccatc
tcaggatgcccactctatcataacctctcagctgacgaatgcaaggtgagagcacagagc
cgggataagcagatagaagaaaggatgctgtctcacaggcaagatgacaacaacaggcat
gcaaccaggcaccaggcaccaacggagaggcagcttcgatacaaggaaaaagtggctgaa
ctcaggaagaaaagaaattctggactgagcaaagaacagaaagagaaatacatggaacac
agacagacctatgggaacacacgggaacctctcttagaaaacctgacaagtgagtatgac
ttggatcttttccgaagagcacaagcccgggcttcagaggatttggagaaattaaggctg
caaggccaaatcacagagggaagcaacatgattaaaacaattgcttttggccgctatgag
cttgatacctggtaccattctccatatcctgaagaatatgcacggctgggacgtctctat
atgtgtgaattctgtttaaaatatatgaagagccaaacgatactccgccggcacatggcc
aaatgtgtgtggaaacacccacctggtgatgagatatatcgcaaaggttcaatctctgtg
tttgaagtggatggcaagaaaaacaagatctactgccaaaacctgtgcctgttggccaaa
ctttttctggaccataagacattatattatgatgtggaacccttcctgttctatgttatg
acagaggcggacaacactggctgtcacctgattggatatttttccaaggaaaagaattca
ttcctcaactacaacgtatcctgtatccttaccatgcctcagtacatgagacagggctat
ggcaagatgcttattgatttcagttatttgctttccaaagtcgaagaaaaagttggctcc
ccagaacgtccactctcagatctggggcttataagctatcgcagttactggaaagaagta
cttctccgctacctgcataatttccaaggcaaagagatttctatcaaagaaatcagtcag
gagacggctgtgaatcctgtagacattgtcagcactctacaagcccttcagatgctcaag
tactggaagggaaaacacctcgttttaaagagacaggacctgattgatgagtggatagcc
aaagaggccaaaaggtccaactccaataaaaccatggatcccagctgcttaaaatggacc
cctcccaagggcacttaa

DBGET integrated database retrieval system