KEGG   Macaca mulatta (rhesus monkey): 703059Help
Entry
703059            CDS       T01028                                 

Gene name
MAP3K12
Definition
mitogen-activated protein kinase kinase kinase 12 (EC:2.7.11.25)
Orthology
K04423  
mitogen-activated protein kinase kinase kinase 12 [EC:2.7.11.25]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
Module
MAPK (JNK) signaling
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    703059 (MAP3K12)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     703059 (MAP3K12)
Protein kinases [BR:mcc01001]
 Serine/threonine protein kinases: TKL group
  MLK family
   703059 (MAP3K12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
11
AA seq 890 aa AA seqDB search
MACLHETRTPSPSFGGFVSTLSEASMRKLDPDTSDCTPEKDLTPTQCVLRDVVPLGGQGG
GGPSPSPGGEPPPEPFANSVLQLHEQDAGGPGGAAGSPESRASRVRADEVRLQCQSGSGF
LEGLFGCLRPVWTMIGKAYSTEHKQQQEDLWEVPFEEILDLQWVGSGAQGAVFLGRFHGE
EVAVKKVRDLKETDIKHLRKLKHPNIITFKGVCTQAPCYCILMEFCAQGQLYEVLRAGRP
VTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGTSKELSDKSTK
MSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSL
HLPVPSSCPDGFKILLRQCWNSKPRNRPSFRQILLHLDIASADVLSTPQETYFKSQAEWR
EEVKLHFEKIKSEGTCLHRLEEELVMRRREELRHALDIREHYERKLERANNLYMELNALM
LQLELKERELLRREQALERRCPGLLKTHPSRGLLHGNTMEKLIKKRNVPQKLSPHSKRPD
ILKTESLLPKLDAALSGVGLPGCPKGPPSPGRSRRGKTRHRKASAKGSCGDLPGLRTAVP
PNEPGGPGSLGGGPSAWEACPPALRGLHHDLLLRKMSSSSPDLLSAALGSRGRGATSGAG
DPGSPPPARGDTPPSEGSAPGSTSPDSPGGAKGEPPPPVGPGEGVGLLGTGREGTSGRGG
SRAGSQHLTPAALLYRAAVTRSQKRGISSEEEEGEVDSEVELTSSQRWPQSLNMRQSLST
FSSENPSDGEEGTASEPSPSGTPEVGSTNTDERPDERSDDMCSQGSEIPLDPPPSEVIPS
PEPSSLPIPHQELLRGKQGPPNSEDSDCDSTELDNSSSVDALRPPASLPP
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atggcttgcctccatgagacccgaacaccctctccttcctttgggggcttcgtgtctacc
ctaagtgaggcatccatgcgcaagctggacccagacacttctgactgcactcccgagaag
gacctgacgcctacccagtgtgtacttcgagatgtggtaccccttggtgggcagggtggg
ggagggcccagcccctccccaggtggagagccgccccctgagccttttgccaacagtgtc
ctgcagctacatgagcaggatgcagggggcccagggggcgcagctgggtcacctgagagt
cgggcatccagagttcgagctgatgaggtgcgactgcagtgccagagtggcagtggcttc
cttgagggcctctttggctgcctgcgccctgtctggaccatgattggcaaagcctactcc
actgagcacaagcagcagcaggaagacctttgggaggtcccctttgaggaaatcctggac
ctgcagtgggtgggctcaggggcccagggtgctgtcttcctggggcgcttccacggggag
gaggtggctgtgaagaaggtgcgagacctcaaagaaaccgacatcaagcacttgcgaaag
ctgaagcaccccaacatcatcaccttcaagggtgtgtgtacccaggctccctgctactgc
atcctcatggagttctgcgcccagggccagctatatgaggtactgcgggccggccgccct
gtcaccccctccttactggttgactggtccatgggcatcgccggtggcatgaactacctg
cacctacacaagattatccacagggatctcaagtcacccaacatgctaatcacctacgac
gatgtggtgaagatctcagattttggcacttccaaggagctgagtgacaagagcaccaag
atgtcctttgcagggacagtagcctggatggcccctgaggtgatccgcaatgagcctgtg
tctgagaaggtcgacatctggtccttcggtgtggtgctgtgggaactgctgactggtgag
atcccctacaaagacgtagattcctcagccatcatctggggtgtgggaagcaacagtctc
catctgcccgtgccctccagttgcccagatggtttcaagatcctacttcgccagtgctgg
aatagcaaaccgcgaaatcgcccatcattccgacagattctgctgcatctggacattgcc
tcagctgatgtactctccacaccccaggagacttactttaagtcccaggcagagtggcgg
gaagaagtaaaactgcactttgaaaagataaagtcagaagggacctgtctgcaccgccta
gaagaggaactggtgatgagaaggagggaggagctcagacatgccctggacatcagggag
cactatgaaaggaagctggagagagccaacaacctgtatatggaacttaatgccctcatg
ttgcagctggaactcaaggagagggagctgctcaggcgagagcaagctttagagcggagg
tgcccaggcctgctgaagacacacccttcccggggcctcctgcatggaaacacaatggag
aagcttatcaagaagaggaatgtgccacagaagctgtcaccccatagcaaaagaccagat
atcctcaagacagagtctttgctacctaaactagatgcagccctaagtggggttgggctt
cctgggtgtcctaagggtcccccctcaccaggacggagtcgccgtggcaagacccgtcac
cgcaaggccagcgccaaggggagctgtggggacctgcctgggcttcgtacagctgtgcca
cccaatgaacctggaggaccaggaagcctaggagggggaccctcagcctgggaggcctgc
cctcctgccctccgtgggcttcatcatgacctcctgctccgcaaaatgtcttcttcatcc
ccagacctgctgtcagcagcactagggtcccggggccggggggccacaagcggagctggg
gatcctggctcaccacctccggcccggggtgacaccccaccaagtgagggatcagcccct
ggctccaccagcccagattcacctgggggagccaaaggggagccacctcctccagtaggg
cctggtgaaggtgtggggcttctgggaactggaagggaagggacctcgggccggggagga
agccgggctgggtcccagcacttgaccccagctgcactgctgtacagggctgccgtcacc
cgaagtcagaaacgtggcatctcatcagaagaggaggaaggagaggtggacagtgaagta
gagctgacatcaagccagaggtggcctcagagtctgaacatgcgccagtcactatctacc
ttcagctcagagaatccatcagatggggaggaaggcacagctagtgaaccttcccccagt
ggcacacctgaagtcggcagcaccaacactgatgagcggccagatgagcggtctgatgac
atgtgttcccagggctcagaaatcccactggacccacctccttcagaggtcatccccagc
ccagaacccagctccctgcccattccacaccaggaacttctcagaggaaagcagggccct
cccaattctgaggactcagactgtgacagcactgaattggacaactccagcagcgttgat
gccttgcggcccccagcttccctccctccatga

DBGET integrated database retrieval system