KEGG   Macaca mulatta (rhesus monkey): 703088Help
Entry
703088            CDS       T01028                                 

Gene name
TGFBR2
Definition
transforming growth factor, beta receptor II (70/80kDa) (EC:2.7.11.30)
Orthology
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Osteoclast differentiation
Hippo signaling pathway
Adherens junction
Chagas disease (American trypanosomiasis)
HTLV-I infection
Pathways in cancer
Transcriptional misregulation in cancer
Colorectal cancer
Pancreatic cancer
Chronic myeloid leukemia
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mcc04010]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:mcc04350]
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:mcc04390]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:mcc04068]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:mcc04060]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:mcc04144]
Cellular Processes; Cell communication; Adherens junction [PATH:mcc04520]
Organismal Systems; Development; Osteoclast differentiation [PATH:mcc04380]
Human Diseases; Cancers; Pathways in cancer [PATH:mcc05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:mcc05202]
Human Diseases; Cancers; Colorectal cancer [PATH:mcc05210]
Human Diseases; Cancers; Pancreatic cancer [PATH:mcc05212]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:mcc05220]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:mcc05166]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:mcc05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 567 aa AA seqDB search
MGRGLLRGLWPLHIVLWTRIASTIPPHVQKSVNNDMMVTDNNGAVKFPQLCKFCDVRFST
CDNQKSCLSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPK
CIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQVTGISLLPPLGVAI
SVIIIFYCYRVNRQQKLSSSWEAGKPRKLMDFSEHCAIILEDDRSDISSTCANNINHNTE
LLPIELDTLVGKGRFAEVYKAKLKQNTSEQFETVAVKIFPYEEYASWKTEKDIFSDINLK
HENILQFLTAEERKTELGKQYWLITAFHAKGNLQEYLTRHVISWEDLRKLGSSLARGIAH
LHSDHTPCGRPKMPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVG
TARYMAPEVLESRMNLENVESFKQTDVYSMALVLWEMTSRCNAVGEVKDYEPPFGSKVRE
HPCVESMKDNVLRDRGRPEIPSFWLNHQGIQMVCETLTECWDHDPEARLTAQCVAERFSE
LEHLDRLSGRSCSEEKIPEDGSLNTTK
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgggggctgctcaggggcctgtggccgctgcacatcgtcctgtggacgcgtatc
gccagcacgatcccaccgcacgttcagaagtcggttaacaatgacatgatggtcactgac
aacaatggtgcagtcaagtttccacaactgtgtaaattttgtgatgtgagattttccacc
tgtgacaaccagaaatcctgcctgagcaactgcagcatcacctccatctgtgaaaagcca
caggaagtctgtgtggctgtatggagaaagaatgacgagaacataacactagagacagtt
tgccatgatcccaagctcccctaccatgactttattctggaagatgctgcttctccaaag
tgcattatgaaggaaaaaaaaaagcctggtgagactttcttcatgtgttcctgtagctct
gatgagtgcaatgacaacatcatcttctcagaagaatacaacaccagcaatcctgacttg
ttgctagtcatatttcaagtgacaggcatcagcctcctgccaccactgggagttgccata
tctgtcatcatcatcttctactgctaccgcgttaaccggcagcagaagctgagctcatcc
tgggaagctggcaagccacggaagctcatggacttcagcgagcactgtgccatcatcctg
gaagacgaccgctccgacatcagctccacatgcgccaacaacatcaaccacaacacagag
ctgctgcccattgaactggacaccctggtggggaaaggtcgctttgctgaggtctataag
gccaagctgaagcagaacacttcagagcagtttgagacagtggcagtcaagatctttccc
tatgaggagtatgcctcttggaagacggagaaggacatcttctcagacatcaacctgaag
catgagaacatactccagttcctgacagctgaggagcgcaagacggagttggggaagcag
tactggctgatcactgccttccatgccaagggcaacctacaggagtacctgacgcggcat
gtcatcagctgggaggacctgcgcaaactgggcagctccctcgcccggggcattgcccac
ctccacagtgatcacactccgtgcgggaggcccaagatgcccatcgtgcacagggacctc
aagagctccaatatcctcgtgaagaacgacctgacctgctgcctgtgtgactttgggctt
tccctgcgtctggaccctactctgtctgtggatgacctggctaacagcgggcaggtggga
actgcaagatacatggctccagaagtcctagaatccaggatgaatttggagaatgtagag
tcctttaagcagaccgatgtctactccatggctctggtgctctgggaaatgacatcgcgc
tgtaatgcggtgggagaagtaaaagattatgagcctccatttggttccaaggtgcgggag
cacccctgtgtcgaaagcatgaaggacaacgtgttgagagatcgaggacgaccagaaatt
cccagcttctggctcaaccaccagggcatccagatggtgtgtgagacgttgactgagtgc
tgggaccacgacccagaggcccgcctcacagcccagtgtgtggcagaacgcttcagtgag
ctggagcacctggacaggctctcggggaggagctgctccgaggagaagattcctgaagac
ggctccctaaacactaccaaatag

DBGET integrated database retrieval system