KEGG   Macaca mulatta (rhesus monkey): 703129Help
Entry
703129            CDS       T01028                                 

Gene name
GLA
Definition
galactosidase, alpha
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    703129 (GLA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    703129 (GLA)
   00600 Sphingolipid metabolism
    703129 (GLA)
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    703129 (GLA)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    703129 (GLA)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     703129 (GLA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
X
AA seq 429 aa AA seqDB search
MQLRNPEMHLGCALALLFLALVSWDIPGARALDNGLARTPTMGWLHWERFMCNLDCQEEP
DSCISEKLFMEMAELMVSDGWKDAGYEYLCIDDCWMAPQRDLEGRLQADPQRFPHGIRQL
ANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTFADWGVDLLKFDGCYCDSLEKL
ADGYKHMSLALNRTGRSIVYSCEWPLYMWPFQKPNYTEIRQYCNHWRNFADIDDSWKSIK
SILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFGLSWNQQVTQMALWAIMAAPLFMSNDL
RHISPQAKALLQDKDVIAINQDPLGKQGYQLRQGDNFEVWERPLSDLAWAVAMINRQEIG
GPRSYTIAVASLGKGVACNPACFITQLLPVKRKLGFYEWTSRLRSHINPTGTVLLRLENT
MQMSIKDLL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgaggaacccagaaatgcatctgggctgcgcgcttgcgcttctcttcctggcc
ctcgtttcctgggacatccctggggccagagcactggacaatggattggccaggacgcct
accatgggctggctgcactgggagcgcttcatgtgcaaccttgactgccaggaagagcca
gattcctgcatcagtgagaagctcttcatggagatggcagagctcatggtctcagatggc
tggaaggatgcaggttatgagtacctctgcattgatgactgttggatggctccccaaaga
gatttagaaggcagacttcaggcagaccctcagcgctttcctcatgggattcgccagcta
gctaattatgttcacagcaaaggactgaagctagggatttatgcagatgttggaaataaa
acctgcgcaggcttccctgggagttttggatactatgacattgatgcccagacctttgct
gactggggagtagatctgctgaaatttgatggttgttactgtgacagtttggaaaagttg
gcagatggttataagcacatgtccttggccctgaataggactggcagaagcattgtgtac
tcctgtgagtggcctctttatatgtggccatttcaaaagcccaattacacagaaatccga
cagtactgcaatcactggcgaaattttgctgacattgatgattcctggaaaagtataaag
agtatcttggactggacatcttttaaccaggagagaattgttgatgttgctggaccaggg
ggttggaatgacccagatatgttagtgattggcaactttggcctcagctggaatcagcaa
gtaactcagatggccctctgggctatcatggctgctcctttattcatgtctaatgacctc
cgacacatcagccctcaagccaaagctctccttcaggataaggatgtaattgccatcaat
caggaccccttgggcaagcaggggtaccagcttagacagggagacaactttgaagtatgg
gaacgacctctctcagacttagcctgggctgtagctatgataaaccggcaggagatcggt
ggacctcgctcttataccatcgcggttgcttccctgggtaaaggagtggcctgtaatcct
gcttgcttcatcacacagctcctccctgtgaaaaggaagctagggttctatgaatggact
tcaaggttaagaagtcacataaatcccacaggcactgttttgcttcggctagaaaataca
atgcagatgtcaattaaagacttactttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system