KEGG   Macaca mulatta (rhesus monkey): 703293Help
Entry
703293            CDS       T01028                                 

Gene name
PLCZ1
Definition
phospholipase C, zeta 1
Orthology
K05861  
phosphatidylinositol phospholipase C, zeta [EC:3.1.4.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    703293 (PLCZ1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    703293 (PLCZ1)
   04070 Phosphatidylinositol signaling system
    703293 (PLCZ1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    703293 (PLCZ1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    703293 (PLCZ1)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     703293 (PLCZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
11
AA seq 608 aa AA seqDB search
MEMKWFLSKIQDDFRGGKINLEKTQRLLEKLDIRCSYIHVKRIFKDNDRLKQGRITIEEF
RAIYRILTHREEIVEIFNAYSENRKILLENNLVQFLTQEQYTTEMSKTIAFEIIQKYEPI
EEVRKARQMSLEGFTRYMDSRECQLFKNECRKVYQDMTHPLNDYFISSSHNTYLVSDQLV
GPSDLWGYVSALVKGCRCLEIDCWDGAQNEPVVYHGYTLTSKLLFKTVIQAIHKYAFMTS
DYPVVLSLENHCSPAQQEIMADNLQTTFGESLLSDMLADFPDTLPSPEALKFKVLVKNKK
IGTLKETHERKGSDKRGENQDKETGVKKLSGVTLFKKKKTRKLKIALALSDLVIYTKAEK
FKSFQHSRLYQQFNENNSIGETQARKLSKLRAHEFIFHTRKFITRIYPKATRADSSNFNP
QEFWNIGCQMVALNFQTPGLPMDLQNGKFLDNGGSGYILKPHFLRESESYFNPSDIKDSM
PITLTIRLISGIQLPLTHSSSNKGDTLVIIEVFGVPNDQMKQQTRVIKKNAFSPRWNETF
TFIIHVPELALIRFVVESQGLIAGNEFLGQYTLPLLCMNKGYRRVPLFSRMGESLEPASL
FVYVWYVR
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgaaatggtttttgtcgaagattcaggatgactttagaggtggaaaaattaat
ctagaaaaaactcagaggttacttgaaaaattagatattcggtgcagttatattcatgtg
aaacggatatttaaggacaatgacaggctgaaacaaggaagaatcaccatagaagaattt
agagcaatttatcgaattctcacgcacagagaagaaattgttgagattttcaacgcatat
tctgaaaaccggaaaattcttttagaaaataatctggttcaatttctgacacaagaacaa
tatacaactgagatgagtaaaactattgcttttgagatcattcagaaatatgaacctatc
gaagaagttaggaaagcacgccaaatgtcattagaaggttttacaagatatatggattca
cgtgaatgtcaactatttaaaaatgaatgtagaaaagtttatcaagatatgactcatcca
ttaaatgattattttatttcatcttcacataacacatatttggtatctgatcaattagtg
ggaccaagtgacctttggggatatgtaagtgcccttgtgaaaggatgccgttgtttggag
attgattgctgggatggagcacaaaatgaacctgttgtatatcatggctacacactcacc
agcaaacttctgtttaaaactgttatccaagctatacacaagtacgcattcatgacatct
gactacccagtggtgctctctttagaaaatcactgctcccctgcccagcaagaaataatg
gcagacaatttgcagacgacttttggagagtccttgctttctgatatgcttgctgatttt
cctgatactctaccatcaccagaggcactaaaattcaaagtattagttaaaaataagaaa
ataggaaccttaaaggaaacccatgaaagaaaaggttctgataagcgtggagaaaatcaa
gacaaggaaacaggggtaaaaaagttatctggagtaacgcttttcaagaaaaagaagacc
aggaagctaaaaattgctctggccttatctgatcttgtcatttatactaaagctgagaag
ttcaaaagctttcaacattcaagattatatcagcaatttaatgaaaataattctattggg
gagacacaagcccgaaaactttcaaaattgagagcccatgagtttatttttcacaccagg
aagttcattaccagaatatatcccaaagcaacaagagcagactcttctaattttaatccc
caagaattttggaatataggttgtcaaatggtggctttaaatttccagacccctggtctg
cctatggatctgcaaaatgggaaatttttggataatggtggttctggatatattttgaaa
ccacatttcttaagagagagtgaatcatactttaacccaagtgacataaaagacagtatg
ccaattacacttacaataaggctcatcagtggtatccagttgcctcttactcattcatca
tctaacaaaggtgatacattagtaattatagaagtttttggtgttccaaatgatcaaatg
aagcagcagactcgtgtaattaaaaaaaatgcttttagtccaagatggaatgaaacattt
acatttattattcatgtcccagaattggcattgatacgttttgttgttgaaagtcaaggt
ttaatagcaggaaatgaatttcttgggcaatatactttgccacttctatgcatgaacaaa
ggctatcgtcgtgttcctctgttttcccgaatgggtgagagccttgagcctgcttcactg
tttgtttatgtttggtacgtcagataa

DBGET integrated database retrieval system