KEGG   Macaca mulatta (rhesus monkey): 703357Help
Entry
703357            CDS       T01028                                 

Gene name
ALDH18A1
Definition
aldehyde dehydrogenase 18 family, member A1
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    703357 (ALDH18A1)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    703357 (ALDH18A1)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     703357 (ALDH18A1)
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     703357 (ALDH18A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 787 aa AA seqDB search
MLSQVYRCGFQPFNQHLLPWVQCTTVSRSHCIQPSVIRHVRSWSNIPFITVPLSRTHGKS
FAHRGELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSVLQNQGREMMLVTSGAV
AFGKQRLRHEILLSQSVRQALHSGQNQLKEMAIPVLEARACAAAGQSGLMALYEAMFTQY
SICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIVNTNDAVVPPAEPNSDLQGVIS
VKDNDSLAARLAVEMKTDLLIVLSDVEGLFDSPPGSDDAKLIDIFYPGDQQSVTFGTKSR
VGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAGPT
VEQQGEMARXXXXXXXRAEIIHHLADLLTDQRDEILLANKKDLEEAEGRLAAPLLKRLSL
STSKLNSLAIGLRQIAASSQDSVGRVLRRTRIAKNLELEQVTVPIGVLLVIFESRPDCLP
QVAALAIASGNGLLLKGGKEAAHSNRILHLLTQEALSIHGVKEAVQLVNTREEVEDLCRL
DKMIDLIIPRGSSQLVRDIQKAAKGIPVMGHSEGICHMYVDSEASVDKVTRLVRDSKCEY
PAACNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLTFSPSEVKSLRTEY
GDLELCIEVVDNVQDAIDHIHKYGSSHTDVIVTENEDTAEFFLQHVDSACVFWNASTRFA
DGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGKDHVVSDFSEHGSLKYLHENLP
VPQRNTN
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atgttgagtcaagtttaccgctgtgggttccagcctttcaaccaacatctcctgccctgg
gtccagtgtacaaccgtctccagatctcattgtatccagccttcagtcatcagacatgtt
cgttcttggagcaacatcccctttatcactgtacccctcagtcgtacacatggcaagtcc
tttgcccaccgcggtgaactgaagcatgccaagagaatcgtggtgaagctcggcagtgct
gtggtgacccgaggggatgaatgtggcctggccctggggcgcttggcatctattgttgag
caggtatcagtgctgcagaatcagggcagagagatgatgctggtgaccagcggagctgta
gcctttggcaaacaacgcttgcgccatgagatccttctgtctcagagcgtgcggcaggcc
ctacactcggggcagaaccagctgaaagagatggcaattccagtcttagaggcacgagcc
tgtgcagctgccggacagagtgggctgatggccttatatgaggctatgtttacccagtac
agcatctgtgctgcccagattttggtgaccaatttggatttccatgatgagcagaagcgc
cggaacctcaatggaacacttcatgaactccttagaatgaacattgtccccatcgtcaac
acaaatgatgctgttgtccccccagctgagcccaacagtgacctgcagggggttattagt
gttaaagataatgatagcctggctgcccgactggctgtggaaatgaaaactgacctcttg
attgttctttcagatgtagaaggcctttttgacagccccccggggtcagatgatgcaaag
cttattgatatattttatcccggagatcagcagtctgtgacatttggaaccaagtctaga
gtgggaatgggtggcatggaagccaaggtgaaagcagccctctgggctttgcaaggtggc
acttctgttgttattgccaatggaacccacccaaaggtgtctgggcacgtcatcacagac
atcgtggaggggaagaaagttggtaccttcttttcagaagtaaagcctgcaggccctact
gttgagcagcagggagaaatggctcgannnnnnnnnnnnnnnnnnnnaagagcagaaatt
atccatcatctggctgatctgttgacggaccagcgtgatgagatcctgttagccaacaaa
aaagacttggaggaggcagaggggagacttgcagctcctctgctgaaacgtttaagcctc
tccacatccaaattgaacagcctggccatcggtctgcggcagatcgcagcctcctcccag
gacagcgtgggacgtgttttgcgccgcacccgaatcgccaaaaacctggaactggaacaa
gtgactgtcccaattggagttctgctggtgatctttgaatctcgtcctgactgcctaccc
caggtggcagctttggctatcgcaagtggtaacggcttgttactcaaaggagggaaggag
gctgcacacagcaaccggattctccaccttctgacccaggaggccctctcaatccatgga
gtcaaggaggccgtgcagctggtgaataccagagaagaagttgaagatctttgtcgccta
gacaaaatgatagatctgatcattccacgtggctcttcccagctggtcagagacatccag
aaagctgctaaggggattccagtgatggggcacagcgaagggatctgtcacatgtatgtg
gattccgaggccagtgttgataaggtcaccaggctagtcagagactctaaatgtgaatat
ccagctgcctgtaatgctttggagactttgttaatccaccgggatctgctcaggacacca
ttatttgaccagatcattgatatgctgagagtggaacaggtaaaaattcacgcaggcccc
aaatttgcctcctatctgaccttcagcccctccgaagtgaagtcactccgaactgagtat
ggggacctggaattatgcattgaagtagtggacaacgttcaggatgccattgaccacatc
cacaagtacggcagctcccacacggatgtcatcgtcacagagaacgaagacacagcagag
ttcttcctgcagcacgtcgacagtgcctgtgtgttctggaatgccagcactcgctttgct
gatggctaccgctttggactgggagctgaagtgggaatcagtacatcgagaatccatgcc
cggggaccagtaggacttgagggactgcttactactaagtggctgctgcgagggaaggac
cacgtggtctcagatttctcagagcatggaagtttaaagtatcttcatgagaacctcccg
gttcctcagagaaacaccaactga

DBGET integrated database retrieval system