KEGG   Macaca mulatta (rhesus monkey): 703536Help
Entry
703536            CDS       T01028                                 

Gene name
MMP8
Definition
(RefSeq) matrix metallopeptidase 8
  KO
K01402  
matrix metalloproteinase-8 (neutrophil collagenase) [EC:3.4.24.34]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.34  neutrophil collagenase
     703536 (MMP8)
Peptidases [BR:mcc01002]
 Metallo Peptidases
  Family M10
   703536 (MMP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
14
AA seq 476 aa AA seqDB search
MCRFPRPFLYLLKRKIQKLFSTRPSQKPTRCSHLILDFPDSRTDYLEKFYQLPSNQYQST
RKNGTSMIVEKLKEMQRFFGLNVTGKPNEETLDMMKKPRCGVPDSGDFMLTPGNPKWERT
NLTYSILNYTPQLSETDVEGAIKKAFEVWSKASPLTFTRISQGQADINIAFFQRDHGDNS
PFDGPNGILAHAFQPGQGIGGDAHFDAEETWTKTSTNYNLFLVAAHEFGHSLGLAHSSDP
GALMYPNYAFRETSNYSLPQDDINGIQAIYGPSSNPIQPTGPSTPKSCDPRLTFDAITTL
RGEILFFKDEYFWRRHPHLQSVEMNFISLFWPSLPTGIQAAYEDFDRDLIFLFKGNQYWA
VSGYDIQQGYPRDISNYGFPSSVQAIDAAVFYRSKTYFFVNDQFWRYDNQRQFMEPGYPK
SISGTFPGIENKVDAVFQQEHFFLFFSGPRYYAFDLIAERVTRVARANKWLNCRYS
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtgcagatttccaaggcctttcctgtatcttctaaagaggaaaatacaaaaattgttc
agcacaaggccatctcagaagccaaccagatgcagccacctgatcttggacttcccagac
tccagaactgactacctggaaaagttctaccaattaccaagcaaccagtatcagtctaca
aggaagaatggcactagcatgattgttgaaaagcttaaagaaatgcaacgattttttggg
ttgaatgtgacggggaagccaaatgaggaaactctggacatgatgaaaaagcctcgctgt
ggagtgcctgacagtggtgattttatgttaaccccaggaaaccccaagtgggaacgcact
aatttgacctacagcattctaaactatacaccgcagctgtcagagactgatgtagaagga
gctattaagaaagcctttgaagtctggagtaaggcgtcacctctcaccttcaccaggatc
tcacagggacaagcagatatcaacattgcttttttccaaagagatcacggtgacaattct
ccatttgatggacccaatggaatccttgctcatgcctttcagccaggccaaggtattgga
ggagatgctcattttgatgccgaagaaacatggaccaaaacctccacaaattacaacttg
tttcttgttgctgctcatgaatttggccattctttggggctcgctcactcctctgaccct
ggtgccttgatgtatcccaattatgctttcagggaaaccagcaactactcactcccacaa
gatgacatcaatggcattcaggccatctatggaccttcaagcaaccctatccaacctact
ggaccaagcacacccaaatcctgcgaccccagattgacatttgatgctatcaccacactc
cgtggagaaatacttttctttaaagacgagtacttctggagaaggcatcctcacctacaa
agtgtcgaaatgaattttatttctctattctggccatcccttccaactggcatacaggct
gcttatgaggattttgacagggacctcattttcctattcaaaggcaaccaatactgggct
gtgagtggctatgacattcagcaaggttatcccagggatatatcaaactatggcttcccc
agcagtgtccaagcaattgacgcagctgttttctacagaagtaaaacatacttctttgta
aatgaccaattctggagatatgataaccaaagacaattcatggaaccaggttatcccaaa
agcatatcaggtacctttccaggaatagagaataaagttgatgcagttttccagcaagaa
cacttcttccttttcttcagtggaccaagatattatgcatttgatcttattgctgagaga
gttaccagagttgcaagagccaataaatggcttaactgtagatatagctga

DBGET integrated database retrieval system