KEGG   Macaca mulatta (rhesus monkey): 703559Help
Entry
703559            CDS       T01028                                 

Gene name
USP42
Definition
ubiquitin specific peptidase 42
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     703559 (USP42)
Peptidases [BR:mcc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   703559 (USP42)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 1317 aa AA seqDB search
MTIVDKASESSDPSAYQNQPGSSEAVSPGDMDAGSASWGAVSSLNDVSNHTLSLGPVPGA
VVYSSSSVPDKSKPSPQKDQALGDGIAPPQKVLFPSEKICLKWQQTHRVGAGLQNLGNTC
FANAALQCLTYTPPLANYMLSHEHSKTCHAEGFCMMCTMQAHITQALSNPGDVIKPMFVI
NEMRRIARHFRFGNQEDAHEFLQYTVDAMQKACLNGSNKLDRHTQATTLVCQIFGGYLRS
RVKCLNCKGVSDTFDPYLDITLEIKAAQSVNKALEQFVKPEQLDGENSYKCSKCKKMVPA
SKRFTIHRSSNVLTLSLKRFANFTGGKIAKDVKYPEYLDIRPYMSQPNGEPIVYVLYAVL
VHTGFNCHAGHYFCYIKASNGLWYQMNDSIVSTSDIRSVLSQQAYVLFYIRSHDVKNGGE
LTHPTHSPGQSSPRPVISQRVVTNKQAAPGFIGPQLPSHMIKNPPHLNGTGPLKDPPSSS
MSSPNGNSSVNRASPVNASASVQNWSVNRSSVIPEHPKKQKITISIHNKLPVRQCQSQPN
LHSNSLENATKPVPSSTITNSAVQSTSNASTMSVSSKVTKPIPRSESCSQPVMNGKSKLN
SSVLVPYGAESSEDSDEESKGLGKENGIGMIASSHSPGRDAEDEEAAPHELQEPMTLNGA
NSADSDSDPKENGLPPDGASCQGQPALHSENPFAKANGIPGKLMPAPLPSLPEDKILETF
KFSNKLKGSTDEMSAPGAERSPPEDGDPEPQPGSPAAESLEEPDAAAASLSSTKKAPPPP
DPGTPTTKEGAWEALAAAPEEPPPGAGQDIAGDTAPPDLCDPGSLTGDASPLSQDAKGMI
AEGPRDSATAEAPEGLSPAPPARSEEPCEQPLLVHPSGDHARDAQDLPQSSGAPEATEGP
PAPVLEAAPAGHLEGDAEPSPGERGEDAAAPKAPGPSPVREKIGSLRKVDRGHYRSRRER
SSSGEPARESRSKTEGHRHRRRRTCPRERDRQDRHAAEHHPGHGDRPSPGERRSLGRYSH
HHSRHRSGAEPDWVRHHYTEGEHGWGREKFYADRPRWDRCRYYHDRYAPYAARDWKPFHG
GREHERAGLHERPHKDHSRGRRGCEPARERERHRPGSPRAGAPHALAPHPDRFSHDRTAL
VAGDNCNLSDRFHEHENVKSRKRRHDSVENSDSHVEKKARRSEQKDPLEEPKAKKHKKSK
KKKKSKDKHRDRDSRHQQDSDLSAACSDADLHRHKKKKKKKKRHSRKSEDFVKDSELHLP
RAASLETVAQFRRAQGGFPLPGGPPLEGVGPFREKTKHLRMESRDDRCHLFEYGQGD
NT seq 3954 nt NT seq  +upstreamnt  +downstreamnt
atgaccatagttgacaaagcttctgaatcttcagacccatcagcctatcagaatcagcct
ggcagctctgaggcagtctcacctggagacatggatgcaggttctgccagctggggtgct
gtgtcttcattaaatgatgtgtcaaatcacacactttctttaggaccagtacctggtgct
gtagtttattcaagttcatctgtacctgataaatcaaaaccatcaccacaaaaggatcaa
gccctaggtgatggcatcgctcctccacagaaagttcttttcccatcagagaagatttgt
cttaagtggcagcaaactcatagagttggagctgggctccagaatttgggcaatacctgt
tttgccaatgcagcactgcagtgtttaacttacacaccacctctcgccaattacatgctc
tcacatgaacactccaaaacatgtcatgcagaaggcttttgtatgatgtgtacaatgcaa
gcacatattacccaggcactcagtaatcctggggacgttattaaaccaatgtttgtcatc
aatgagatgcggcgtatagctaggcacttccgttttggaaaccaggaagatgcccatgaa
ttccttcaatacactgttgatgctatgcaaaaagcatgcttgaatggcagcaataaattg
gacagacacacccaggccaccactctcgtttgtcagatatttggaggatacctaagatct
agagtcaaatgtttaaattgcaagggcgtttcagatacttttgatccatatcttgatata
acattggagataaaggctgctcagagtgttaacaaggcgttggagcagtttgtgaagccg
gaacagcttgatggagaaaactcatacaagtgcagcaagtgtaaaaagatggttccagct
tcaaagaggttcactatccatagatcctctaacgttcttacactttctctgaaacgtttt
gcaaattttactggtggaaaaattgctaaggatgtgaaatatcctgagtatcttgatatt
cggccatatatgtctcaacccaacggagagccgattgtttacgtcttgtatgcagtgctg
gtccacactggttttaattgccatgctggccattacttctgctacataaaagctagcaat
ggcctctggtatcaaatgaatgactccattgtatctaccagtgatattagatcggtactc
agccaacaagcctatgtgctcttttatatcaggtctcatgatgtgaaaaatggaggtgaa
cttactcatcccacccatagccccggccagtcctctccccgccccgtcatcagtcagcgg
gttgtcaccaacaaacaggctgcaccagggtttatcggaccacagcttccctctcacatg
ataaagaatccacctcacttaaatgggactggaccattgaaagacccaccaagcagttcc
atgtcaagtcctaacgggaattccagtgtcaacagggctagtcctgttaatgcttcagct
tctgtccaaaactggtcagttaataggtcttcagtgatcccagaacatcctaagaaacaa
aaaattacaatcagtattcacaacaagttgcctgttcgccagtgtcagtctcagcctaac
cttcatagcaattctttggagaacgctaccaagcccgttccctcttctaccattaccaat
tctgcagtacagtctacctcgaacgcatctacgatgtcagtttctagtaaagtaacaaaa
ccgatcccccgcagcgaatcctgttcccagcccgtgatgaatggcaaatccaagctgaac
tccagtgtgctggtcccctatggcgccgagtcctctgaggactctgacgaggagtcgaag
gggctgggcaaggagaatgggattggtatgattgcgagctcccactctcccggccgagat
gccgaagatgaggaggccgctccgcacgagctccaagaacccatgaccctaaacggtgct
aatagtgcagacagtgacagtgacccaaaagaaaacggcctgccgcccgatggtgccagc
tgccaaggccagcctgccctgcactcagaaaatccctttgctaaggcaaacggtattcct
ggaaagttgatgcctgctcctttgccgtctctcccagaagacaaaatcttagagaccttc
aagtttagcaacaaactgaaaggctcgacagatgaaatgagtgcacctggagcagagagg
agccctcccgaggacggcgaccccgagccccagcctggcagccccgccgccgaatccctg
gaggaaccggatgcagccgccgccagcctcagcagcaccaagaaggccccgccgcccccg
gatcccggcactcccactaccaaagaaggcgcctgggaggccttggctgccgcccccgag
gagcctccgcccggcgctgggcaggacatcgcgggggacacagcgccccctgacctgtgt
gatcccgggagcttaacgggcgacgcgagcccgctgtcccaggacgcaaaggggatgata
gcggagggcccgcgggactctgcgacggcggaagccccggaggggttgagtccggctccg
cctgcgcggtcggaggagccctgcgagcagccgctccttgttcaccctagcggggaccat
gcccgggacgctcaggacctgccccagagctcgggcgcgcccgaggccacagaggggccg
ccagctcctgtgctggaggcggccccggccggtcacctggaaggggacgcagagcctagc
cccggcgagaggggcgaggacgccgcggcgccgaaagctccaggcccttccccggtgagg
gagaaaatcggcagcctcagaaaggtggaccgaggccactaccgcagccggagggagcgc
tcgtccagcggggagcccgccagagagagcaggagcaagactgagggccaccgccaccgg
cggcgccgcacgtgcccccgggagcgcgaccgccaggaccgccacgctgcggagcaccac
cccggccacggcgacaggcccagccccggcgagcgccgctctctgggcaggtacagtcac
caccactcccgacaccggagtggggcggagccggactgggtcagacaccactacaccgag
ggcgagcatggctggggccgggagaagttctacgccgacaggccgcgctgggacaggtgc
cggtactaccatgacaggtacgccccgtacgccgcccgggactggaagcccttccatggc
ggccgcgagcacgagcgggccgggctgcatgagcggccgcacaaggaccacagccggggc
cgtaggggctgcgagccggcccgggagagggagcggcaccgccctggcagcccccgtgca
ggagcgccccacgccctcgccccgcaccctgaccgcttctcccacgacagaactgcactt
gtagctggagacaactgtaacctctctgatcggtttcacgaacacgaaaatgtaaagtca
cggaaacggagacacgacagcgtggaaaacagtgacagccatgtcgaaaagaaagcccgg
aggagtgaacagaaggaccctctagaagagcctaaagcgaagaagcacaaaaaatcaaag
aagaaaaagaaatccaaagacaaacaccgagaccgcgactccaggcatcagcaggactca
gacctctcagcagcgtgctctgacgctgacctccacagacacaaaaaaaagaagaagaaa
aagaagagacattcaagaaaatcagaggactttgttaaagattcagaactgcacttaccc
agggccgccagcttggagactgttgcccagttccggagagcccagggcggctttcctctg
cccggtggcccgcctctggaaggcgtcggacctttccgtgagaaaacgaaacacttacgg
atggaaagcagggatgacaggtgtcatctctttgagtatggccagggtgattga

DBGET integrated database retrieval system