KEGG   Macaca mulatta (rhesus monkey): 703717Help
Entry
703717            CDS       T01028                                 

Definition
histone-lysine N-methyltransferase SETD1B-like
Orthology
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    703717
Enzymes [BR:mcc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     703717
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 2216 aa AA seqDB search
MVPTWTPAFCPPSRCQRRRTPELREAGFGVRNPHDRKGKRAKGWAMRLPRLLSPPSPKHF
NFFSPSRLRPGKSEGGEGRRLHEPPRVAAEPLFSPLGQKRHRGPKSPPCPNPPPTARSGC
QIQCSRILLLPSAPKHSQPLLGLQKGFLEGAKGTFIFLTYPLSPPYRSRALIGCRALPPC
SSQLPTHGQITNPEKSPNMSYTSSEPRRGGSCASAAREKRSAPGRGSRAGGGSWSADTSI
ATPLSRRRPPRAVPSVHTHPRPPRPQPSPRVPARPPPARAVWKQFCRPGTHAAAAAARRP
PPQPGPSGERRNHNWRSYKLMIDPALKKGHHKLYRYDGQHFSLAMSSNRPVEIVEDPRVV
GIWTKNKELELSVPKFKIDEFYVGPVPPKQVTFAKLNDNIRENFLRDMCKKYGEVEEVEI
LYNPKTKKHLGIAKVVFATVRGAKDAVQHLHSTSVMGNIIHVELDTKGETRMRFYELLVT
GRYTPQTLPVGELDAVSPIVNETLQLSDALKRLKDGGLSAGCGSGSSSVTPNSGGTPFSQ
DTAYSSCRLDTPNSYGQGTPLTPRLGTPFSQDSSYSSRQPTPSYLFSQDPAVTFKARRHE
SKFTDAYNRRHEHHYVHNSPAVTAVAGATAAFRGSSDLPFGAVSGTGGSSGPPFKAQPQE
SATFAHTPPPAQATSAPGFKSAFSPYQTPVAHFPPPPEEPTATATATFGARDSGEFRRAP
APPPLPPAEPLAKERPGTPPGPPPPDTNSMELGGRPTFGWSPEPCDSPGTPTLESSPAGP
EKPHDSLDSRIEMLLKEQRTKLLFLREPDSDTELQMEGSPISSSSSQLSPLAPFGTNSQP
GFRGPTPPSSRPSSTGLEDISPTPLPDSDEDEELDLGLGPRPPPEPGPPDPAGLLGQTAE
VALDLGSRQGALAGGVDRCAAVGGPPALAPSFSAPSRLPGVRSVYHADHGPGLRGPEWLE
RKALRGPGSGGLGLPGHQRRQPPSPGKLQAGPRAPPAGTGDXPPPPPPPAHPAVTVPPPP
LPAPPGVPPPPILPPLPPFPPGLFPVMQVDMSHVLGGQWGGMPMSFQMQTQVLSRLMTGQ
GACPYPPFMAAAAAAASAGLQFVNLPPYRGPFSLSNSGPGRGQHWPPLPKFDPSVPPPGY
MPRQEDPHKATVDGVLLVVLKELKAIMKRDLNRKMVEVVAFRAFDEWWDKKERMAKASLT
PVKSGEHKDEDRPKPKDRIASCLLESWGKGEGLGYEGLGLGIGLRGAIRLPSFKVKRKEP
PDTTSSGDQKRLRPSTSVDEEDEESERERDRDMADTPCELAKRDPKGVGVRRRPARPLEL
DSGGEEDEKESLSEEQESTEEEEEEAEEEEEEEDDDDDDSDDRDESENDDEDTALSEASE
KDEGDSDEEETVSIVTSKAEATSSSESSESSEFESSSESSPSSSEDEEEVATREEEEEEE
EEAAMVAEESMASAGPEDFEQDGAEASLALGAPAVDSLGMEEEADIRTEAAAPEERPPML
DEPPLPVGVEEPVDSREPPEEPGLSQEGAMLLSPEPPAREVEARPPLSPERAPEHDLQVE
PEPPMMLPLPLQPPLPPPRPPRPPSPPPEPETTDASHPSVPPEHPAEDHPPHTPGLCGSL
AKSQSTETVPATPGGEPPLSGGSSGLSLSSPQVPGSPFSYPAPSPSLNSGGLPRTPGRDF
SFTPTFSEPSGPLLLPVCPLPTGRRDERSGPLASPVLLETGLPLPLPLPLPLPLALPAVL
RAQARTPTPLPPLLPAPLASCPPPMKRKPGRPRRSPPSMLSLDGPLVRPPAGAALGRELL
LLPGQPQTPVFPSTHDPRTVTLDFRNAGIPAPPPPLPPQPPPPPPPPPVEPTKLPFKELD
NQWPSEAIPPGPRGRDEVTEEYMELAKSRGPWRRPPKKRHEDLVPPAGSPELSPPQPLFR
PRSEFEEMTILYDIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYHPSTSLSSA
KKKKRDDGIREHVTGCARSEGFYTIDKKDKLRYLNSSRASTDEPPADTQGMSIPAQPHAS
TRAGSERRSEQRRLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEPIAAD
EMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNP
NCYAKVITVESQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCRGTLN
NT seq 6651 nt NT seq  +upstreamnt  +downstreamnt
atggtgccaacatggacgccggccttttgtcctccttcgcgttgccagcgcaggcgcacc
ccggagctccgagaagccggcttcggggtgcggaatcctcacgatcgaaagggaaagagg
gccaaaggctgggcgatgaggctccctcgtcttttaagccccccgtctccaaagcacttc
aatttcttctccccatccaggctcagacctgggaagagcgaggggggcgaaggcaggcgg
ctccatgagcccccgagggtcgctgcggagcccctcttctcgcccttggggcagaagagg
cacaggggtccgaagagccctccgtgtcccaaccccccgcccactgcccgctccggctgc
caaatacaatgctccagaatcctccttctcccctcagctcccaaacactcgcagcccttg
cttggcctgcaaaagggtttcctcgaaggggcaaaaggcacttttatttttcttacttac
ccgctcagcccgccctatagaagccgcgcgctgattggctgccgcgccctgccgccctgc
tccagccaattacctacccacggccaaattacaaaccccgaaaagagccccaatatgagc
tacaccagctccgagccccggcgaggcggctcctgcgcctcggccgccagagagaagcgc
tcagctccggggagggggtcgcgggccggaggaggaagctggagcgcagatacctcgatt
gcaactcctctgagtcgacgccggcctccccgcgcggttcccagcgtccacacacaccct
cggccccctagaccccagccctctccccgggtccccgcgcgcccgcctccggcccgggca
gtttggaaacagttttgcaggcccgggacgcacgccgcggcggccgcggctcggaggccc
ccgccgcagcccggcccttcgggcgagaggaggaaccacaattggagaagttacaagttg
atgattgacccggctctgaaaaaggggcatcataaactgtaccgctacgatgggcagcat
ttcagcctggcgatgtccagcaaccgcccggtggaaattgtcgaagatccccgggtcgtc
gggatctggaccaaaaacaaggagctggagctgtcggtgcccaaattcaaaatcgatgag
ttctacgtgggcccggtgcctccgaagcaggtgacatttgccaagctgaatgataacatc
cgcgaaaacttcctgagggacatgtgcaagaagtatggggaggtggaggaggtggagatt
ttgtacaacccgaagaccaagaagcacctgggcatcgccaaggtggtctttgccactgtc
cggggagccaaggatgccgttcagcacttgcacagcacttccgtcatgggcaatattatc
cacgtggagctggacaccaaaggggaaacccgaatgcggttctatgaactgttggtcact
ggccgatataccccccagactctcccagtgggcgagctggacgctgtctctccaatcgtg
aatgagaccctgcagctgtcagatgccctgaagcgcctcaaggatggaggcctatctgca
ggctgtggctccggctcctcctctgtcacccccaatagtggtgggacacccttctcccag
gacacagcttactccagctgccgcctggacacacccaactcctatggacagggcaccccg
ctcacaccgcgcctgggcacccctttctcacaggactctagctactccagccgccagccc
acaccctcatacctcttcagccaggacccggcagtcaccttcaaggcccggcgccatgag
agcaagttcaccgacgcctacaaccgccgccatgaacatcattatgtccacaattctccc
gcggtcactgcggtggctggggccacagccgccttccggggttcctcagacctcccgttc
ggagcagtcagcggcactgggggcagcagtggcccccccttcaaggcccaaccacaggaa
tcggccacatttgcccacactccaccacccgcccaggcaacctctgctcctggattcaag
tctgctttctctccatatcagaccccagtggcccacttccctccacccccagaagagccc
acagccacagccacagccacctttggggcccgcgacagcggggagttccggagggcaccg
gcgcccccacccctgccacctgctgagcctctggccaaggagaggccaggcacgccaccg
ggccctccgccccccgacaccaacagcatggagctggggggccggcccaccttcggctgg
agtcctgagccctgtgacagccccggcacgcccacgctggagtcatcccctgcagggcca
gagaagccccacgacagcctggactcgcgcattgagatgctgctgaaggagcagcgcacc
aagctgctcttcctgcgggagccagactccgacactgagctgcagatggagggcagcccc
atctcctcctcctcctcccagctctccccactggccccctttggcaccaactcccagcca
ggcttccgaggccccacgcccccctcctcacgcccctccagcaccggcctggaggacatc
agcccaacacccctgccagactccgatgaggacgaggagctcgacttgggccttgggcct
cggcctccacccgagccaggccccccggaccctgctgggcttctgggccagacagctgag
gtggccttggacctggggtccaggcagggggccttggcagggggcgttgacaggtgtgca
gctgtaggggggccgccggccctggcaccctccttctccgctccgtccaggctgcctggg
gtgaggagtgtttaccatgctgaccatggtccagggctgagaggcccggagtggctggag
cgaaaggcactcagaggccccgggagcgggggtctgggactgcccggccaccagcggagg
cagccgccgagtcctgggaagcttcaggccggcccgcgagcgccccctgctggcaccgga
gactancccccacccccaccccctccagcccaccctgctgtgacagtgcccccaccaccc
ctgccagcgccacctggagtcccgccccctcccatcctgccaccactgcccccctttccg
ccgggcctgttccctgtgatgcaggtggacatgagccacgtgctgggtggccagtggggt
ggcatgcccatgtccttccagatgcaaacgcaggtgctcagtcggctgatgacgggccag
ggtgcctgcccctacccgcccttcatggccgctgcagccgctgctgcctcagctgggctc
cagttcgtcaacctgccgccctaccggggccccttctccctgagcaactccggcccaggc
cgcgggcagcactggccaccactgcccaaatttgacccatcagtgcctccaccaggctac
atgccgcgccaggaggacccgcacaaagccacggtggatggcgtcctgctggtggtcctc
aaagagctcaaggccatcatgaagcgtgacctgaatcgcaagatggtggaagtggtggct
ttccgggccttcgacgagtggtgggacaagaaggagcggatggccaaggcctcactgacc
ccggtgaagtccggcgagcacaaggacgaggacaggccgaagcccaaggaccgcatcgcc
tcatgcctgttggagtcatggggcaagggtgagggcctgggctacgagggcctgggcctg
ggcattgggctgcgtggggccattcgcctgccctccttcaaggttaagaggaaggagcca
ccagacaccacctcatctggcgaccagaagcggctgcggccctcgacctctgtggatgag
gaagatgaagagtccgagcgagagcgagaccgggacatggcagacaccccctgtgagctc
gccaagcgggaccccaagggcgtgggtgtgcggcggcggccggcgcggcctctggagctg
gacagtggcggggaggaggacgagaaggagtccttgtcggaagaacaggagagcaccgag
gaggaggaggaagaggcagaggaggaggaggaggaagaggatgacgacgatgatgacagt
gatgaccgggacgagtctgagaacgatgacgaagacacagccctgtcagaggcgagtgag
aaggatgaaggggactcggatgaagaggagacagtgagcattgtaacctccaaggctgaa
gccacgtcatccagcgagagttccgagtcttctgagtttgagtcaagctccgagtcctca
ccctcatcctcagaggatgaagaggaggtagcgaccagggaagaggaggaagaagaagag
gaggaggcggcgatggtggcagaggaaagcatggcttctgcaggccctgaggactttgag
caggacggggcggaagcttctctggccctgggggcaccagcagtggactcgttgggcatg
gaagaggaggcggacatcaggactgaggctgcagcccctgaggagcggccccccatgctg
gatgagccccccttgcctgtgggtgttgaagagccagtggactccagggagccccctgag
gagccaggcctgagccaggaaggggccatgttgctgtctccagagccccctgccagggag
gtggaggcccgacccccattatcccctgaacgagctccagagcatgacctgcaagtggag
ccagagccccctatgatgctccccttgcccctgcaaccaccattgccgcccccacgacca
ccccggccacccagcccaccgccggagcccgagaccacagacgcctcacatccatctgtc
cctccggagcaccctgctgaagaccaccccccacatactccaggcctctgtggcagcctg
gccaagtcgcagagcacagagacagtgccagccacaccaggcggggagcccccgctatca
gggggcagcagtggcctgtccttgagctctccgcaagtgcccggcagccccttctcctac
ccagccccgtcccccagcttgaacagtgggggcctccctcggacacctggccgggacttc
agcttcacacccaccttctccgagcccagtgggccgttgcttctgcccgtctgccccctc
cccactggccgacgtgatgaacgctccgggcccctggcttccccggtgctcctggagacg
ggcctgcccctccctctgcccctgcccctgcccttgcccttggcattacccgctgtcttg
cgggcccaggctcgtacccccaccccgctgccacccttgctgcctgcccccctggcctct
tgcccacccccaatgaagagaaagccgggccggccccggcgatccccaccatctatgctc
tccttggatgggcccttggtccggccaccagcaggggccgcccttggaagggaactcctg
ctcctgccgggccagccgcagacccccgtcttccccagcactcacgacccccggacagtg
accctggatttccggaacgcggggatcccagcccctccaccaccccttcccccccagcca
cccccacccccacctcccccacctgtagagcccaccaagctgccctttaaggagctagac
aaccagtggccctccgaggccatccctccaggcccccgtgggcgtgatgaggtcactgag
gagtacatggagttggccaagagtcgggggccgtggcgccggccacctaagaagcgccat
gaggacctggtgccacctgcgggctcgcccgaactctcgccaccccagcccctcttccgg
ccccgctcagagtttgaggagatgaccatcctgtatgacatctggaacggtggcatcgac
gaggaggacatccgcttcctatgtgtcacttacgagcgactgctgcagcaggacaatggc
atggactggcttaacgacacgctctgggtctaccatccctccaccagcctctcttcagct
aagaaaaagaaacgggacgatggcattcgtgagcacgtgacaggctgtgcccgcagcgag
ggcttctacaccatcgacaagaaggacaagctcagatacctcaacagcagccgtgccagc
accgatgagccccctgcagacacccagggcatgagcatcccagcacagccccatgcctcc
acccgggcaggctcggagcgacgttcggagcagcgtcgcctgctgtcctccttcactggc
agctgtgacagcgacctgctcaagttcaaccagctcaagttccggaagaaaaagctcaag
ttctgcaagagccacattcatgactggggcttgttcgccatggagcccatcgcggctgac
gagatggtcatcgagtacgtgggccagaatatccgtcaggtgatcgcagacatgcgggag
aagcgttatgaggacgagggcatcgggagcagctacatgttccgggtggaccacgacacc
atcatcgacgccaccaaatgcggcaacttcgcgcgcttcatcaaccacagctgcaacccc
aactgctatgccaaggtgatcacggtggagtcgcagaagaagatagtcatctactcgaag
cagcacatcaacgtcaacgaggagatcacctatgactacaagttccccatcgaggacgtc
aagatcccctgcctctgcggctccgagaactgccggggcaccctcaactag

DBGET integrated database retrieval system