KEGG   Macaca mulatta (rhesus monkey): 703717Help
Entry
703717            CDS       T01028                                 

Gene name
SETD1B
Definition
(RefSeq) SET domain containing 1B
  KO
K11422  
histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    703717 (SETD1B)
Enzymes [BR:mcc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     703717 (SETD1B)
Chromosome [BR:mcc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     703717 (SETD1B)
   HMT complexes
    COMPASS/SET1 complex
     703717 (SETD1B)
    COMPASS/SET1 complex (yeast)
     703717 (SETD1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
11
AA seq 1928 aa AA seqDB search
MIDPALKKGHHKLYRYDGQHFSLAMSSNRPVEIVEDPRVVGIWTKNKELELSVPKFKIDE
FYVGPVPPKQVTFAKLNDNIRENFLRDMCKKYGEVEEVEILYNPKTKKHLGIAKVVFATV
RGAKDAVQHLHSTSVMGNIIHVELDTKGETRMRFYELLVTGRYTPQTLPVGELDAVSPIV
NETLQLSDALKRLKDGGLSAGCGSGSSSVTPNSGGTPFSQDTAYSSCRLDTPNSYGQGTP
LTPRLGTPFSQDSSYSSRQPTPSYLFSQDPAVTFKARRHESKFTDAYNRRHEHHYVHNSP
AVTAVAGATAAFRGSSDLPFGAVSGTGGSSGPPFKAQPQESATFAHTPPPAQATSAPGFK
SAFSPYQTPVAHFPPPPEEPTATATATFGARDSGEFRRAPAPPPLPPAEPLAKERPGTPP
GPPPPDTNSMELGGRPTFGWSPEPCDSPGTPTLESSPAGPEKPHDSLDSRIEMLLKEQRT
KLLFLREPDSDTELQMEGSPISSSSSQLSPLAPFGTNSQPGFRGPTPPSSRPSSTGLEDI
SPTPLPDSDEDEELDLGLGPRPPPEPGPPDPAGLLGQTAEVALDLVGDRTPTSEKMDEGQ
QSSGEDMEISDDEMPSAPITSADCPKPMVVTPGAGSWAAPSVLAPTLPLPPTTRFPRFPT
PPTTPPQPVPPXPPPPPPPAHPAVTVPPPPLPAPPGVPPPPILPPLPPFPPGLFPVMQVD
MSHVLGGQWGGMPMSFQMQTQVLSRLMTGQGACPYPPFMAAAAAAASAGLQFVNLPPYRG
PFSLSNSGPGRGQHWPPLPKFDPSVPPPGYMPRQEDPHKATVDGVLLVVLKELKAIMKRD
LNRKMVEVVAFRAFDEWWDKKERMAKASLTPVKSGEHKDEDRPKPKDRIASCLLESWGKG
EGLGYEGLGLGIGLRGAIRLPSFKVKRKEPPDTTSSGDQKRLRPSTSVDEEDEESERERD
RDMADTPCELAKRDPKGVGVRRRPARPLELDSGGEEDEKESLSASSSSSASSSSGSSTTS
PSSSASDKEEEQESTEEEEEEAEEEEEEGPDSLLSSSSTSSTSDKDDDDDDSDDRDESEN
DDEDTALSEASEKDEGDSDEEETVSIVTSKAEATSSSESSESSEFESSSESSPSSSEDEE
EVATREEEEEEEEEAAMVAEESMASAGPEDFEQDGAEASLAPGAPAVDSLGMEEEADIRT
EAAAPEERPPMLDEPPLPVGVEEPVDSREPPEEPGLSQEGAMLLSPEPPAREVEARPPLS
PERAPEHDLQVEPEPPMMLPLPLQPPLPPPRPPRPPSPPPEPETTDASHPSVPPEHPAED
HPPHTPGLCGSLAKSQSTETVPATPGGEPPLSGGSSGLSLSSPQVPGSPFSYPAPSPSLN
SGGLPRTPGRDFSFTPTFSEPSGPLLLPVCPLPTGRRDERSGPLASPVLLETGLPLPLPL
PLPLPLALPAVLRAQARTPTPLPPLLPAPLASCPPPMKRKPGRPRRSPPSMLSLDGPLVR
PPAGAALGRELLLLPGQPQTPVFPSTHDPRTVTLDFRNAGIPAPPPPLPPQPPPPPPPPP
VEPTKLPFKELDNQWPSEAIPPGPRGRDEVTEEYMELAKSRGPWRRPPKKRHEDLVPPAG
SPELSPPQPLFRPRSEFEEMTILYDIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTL
WVYHPSTSLSSAKKKKRDDGIREHVTGCARSEGFYTIDKKDKLRYLNSSRASTDEPPADT
QGMSIPAQPHASTRAGSERRSEQRRLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHD
WGLFAMEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCG
NFARFINHSCNPNCYAKVITVESQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGS
ENCRGTLN
NT seq 5787 nt NT seq  +upstreamnt  +downstreamnt
atgattgacccggctctgaaaaaggggcatcataaactgtaccgctacgatgggcagcat
ttcagcctggcgatgtccagcaaccgcccggtggaaattgtcgaagatccccgggtcgtc
gggatctggaccaaaaacaaggagctggagctgtcggtgcccaaattcaaaatcgatgag
ttctacgtgggcccggtgcctccgaagcaggtgacatttgccaagctgaatgataacatc
cgcgaaaacttcctgagggacatgtgcaagaagtatggggaggtggaggaggtggagatt
ttgtacaacccgaagaccaagaagcacctgggcatcgccaaggtggtctttgccactgtc
cggggagccaaggatgccgttcagcacttgcacagcacttccgtcatgggcaatattatc
cacgtggagctggacaccaaaggggaaacccgaatgcggttctatgaactgttggtcact
ggccgatataccccccagactctcccagtgggcgagctggacgctgtctctccaatcgtg
aatgagaccctgcagctgtcagatgccctgaagcgcctcaaggatggaggcctatctgca
ggctgtggctccggctcctcctctgtcacccccaatagtggtgggacacccttctcccag
gacacagcttactccagctgccgcctggacacacccaactcctatggacagggcaccccg
ctcacaccgcgcctgggcacccctttctcacaggactctagctactccagccgccagccc
acaccctcatacctcttcagccaggacccggcagtcaccttcaaggcccggcgccatgag
agcaagttcaccgacgcctacaaccgccgccatgaacatcattatgtccacaattctccc
gcggtcactgcggtggctggggccacagccgccttccggggttcctcagacctcccgttc
ggagcagtcagcggcactgggggcagcagtggcccccccttcaaggcccaaccacaggaa
tcggccacatttgcccacactccaccacccgcccaggcaacctctgctcctggattcaag
tctgctttctctccatatcagaccccagtggcccacttccctccacccccagaagagccc
acagccacagccacagccacctttggggcccgcgacagcggggagttccggagggcaccg
gcgcccccacccctgccacctgctgagcctctggccaaggagaggccaggcacgccaccg
ggccctccgccccccgacaccaacagcatggagctggggggccggcccaccttcggctgg
agtcctgagccctgtgacagccccggcacgcccacgctggagtcatcccctgcagggcca
gagaagccccacgacagcctggactcgcgcattgagatgctgctgaaggagcagcgcacc
aagctgctcttcctgcgggagccagactccgacactgagctgcagatggagggcagcccc
atctcctcctcctcctcccagctctccccactggccccctttggcaccaactcccagcca
ggcttccgaggccccacgcccccctcctcacgcccctccagcaccggcctggaggacatc
agcccaacacccctgccagactccgatgaggacgaggagctcgacttgggccttgggcct
cggcctccacccgagccaggccccccggaccctgctgggcttctgggccagacagctgag
gtggccttggacctggttggagacagaacgccgacctcagagaagatggatgagggccag
cagtcctcaggcgaggacatggagatctcggatgacgagatgccctcagcccccatcacc
agcgccgattgccccaagcccatggtggtgaccccaggagcgggcagctgggcagcccct
tccgtgctggccccaaccctgccgctgccccccaccacccgcttcccccgcttccccacc
ccccccaccaccccaccgcagcctgttcccccantgcccccacccccaccccctccagcc
caccctgctgtgacagtgcccccaccacccctgccagcgccacctggagtcccgccccct
cccatcctgccaccactgcccccctttccgccgggcctgttccctgtgatgcaggtggac
atgagccacgtgctgggtggccagtggggtggcatgcccatgtccttccagatgcaaacg
caggtgctcagtcggctgatgacgggccagggtgcctgcccctacccgcccttcatggcc
gctgcagccgctgctgcctcagctgggctccagttcgtcaacctgccgccctaccggggc
cccttctccctgagcaactccggcccaggccgcgggcagcactggccaccactgcccaaa
tttgacccatcagtgcctccaccaggctacatgccgcgccaggaggacccgcacaaagcc
acggtggatggcgtcctgctggtggtcctcaaagagctcaaggccatcatgaagcgtgac
ctgaatcgcaagatggtggaagtggtggctttccgggccttcgacgagtggtgggacaag
aaggagcggatggccaaggcctcactgaccccggtgaagtccggcgagcacaaggacgag
gacaggccgaagcccaaggaccgcatcgcctcatgcctgttggagtcatggggcaagggt
gagggcctgggctacgagggcctgggcctgggcattgggctgcgtggggccattcgcctg
ccctccttcaaggttaagaggaaggagccaccagacaccacctcatctggcgaccagaag
cggctgcggccctcgacctctgtggatgaggaagatgaagagtccgagcgagagcgagac
cgggacatggcagacaccccctgtgagctcgccaagcgggaccccaagggcgtgggtgtg
cggcggcggccggcgcggcctctggagctggacagtggcggggaggaggacgagaaggag
tccttgtcggcgtcgtcctcctcatcggcgtcatcatcctcggggtcctcaaccacctca
ccctcgtcttcggcctccgacaaggaggaagaacaggagagcaccgaggaggaggaggaa
gaggcagaggaggaggaggaggaaggcccggactccttgctgtcctcctcctcaacctca
tccacatcagataaggatgacgacgatgatgacagtgatgaccgggacgagtctgagaac
gatgacgaagacacagccctgtcagaggcgagtgagaaggatgaaggggactcggatgaa
gaggagacagtgagcattgtaacctccaaggctgaagccacgtcatccagcgagagttcc
gagtcttctgagtttgagtcaagctccgagtcctcaccctcatcctcagaggatgaagag
gaggtagcgaccagggaagaggaggaagaagaagaggaggaggcggcgatggtggcagag
gaaagcatggcttctgcaggccctgaggactttgagcaggacggggcggaagcttctctg
gccccgggggcaccagcagtggactcgttgggcatggaagaggaggcggacatcaggact
gaggctgcagcccctgaggagcggccccccatgctggatgagccccccttgcctgtgggt
gttgaagagccagtggactccagggagccccctgaggagccaggcctgagccaggaaggg
gccatgttgctgtctccagagccccctgccagggaggtggaggcccgacccccattatcc
cctgaacgagctccagagcatgacctgcaagtggagccagagccccctatgatgctcccc
ttgcccctgcaaccaccattgccgcccccacgaccaccccggccacccagcccaccgccg
gagcccgagaccacagacgcctcacatccatctgtccctccggagcaccctgctgaagac
caccccccacatactccaggcctctgtggcagcctggccaagtcgcagagcacagagaca
gtgccagccacaccaggcggggagcccccgctatcagggggcagcagtggcctgtccttg
agctctccgcaagtgcccggcagccccttctcctacccagccccgtcccccagcttgaac
agtgggggcctccctcggacacctggccgggacttcagcttcacacccaccttctccgag
cccagtgggccgttgcttctgcccgtctgccccctccccactggccgacgtgatgaacgc
tccgggcccctggcttccccagtgctcctggagacgggcctgcccctccctctgcccctg
cccctgcccttgcccttggcattacccgctgtcttgcgggcccaggctcgtacccccacc
ccgctgccgcccttgctgcctgcccccctggcctcttgcccacccccaatgaagagaaag
ccgggccggccccggcgatccccaccatctatgctctccttggatgggcccttggtccgg
ccaccagcaggggccgcccttggaagggaactcctgctcctgccgggccagccgcagacc
cccgtcttccccagcactcacgacccccggacagtgaccctggatttccggaacgcgggg
atcccagcccctccaccaccccttcccccccagccacccccacccccacctcccccacct
gtagagcccaccaagctgccctttaaggagctagacaaccagtggccctccgaggccatc
cctccaggcccccgtgggcgtgatgaggtcactgaggagtacatggagttggccaagagt
cgggggccgtggcgccggccacctaagaagcgccatgaggacctggtgccacctgcgggc
tcgcccgaactctcgccaccccagcccctcttccggccccgctcagagtttgaggagatg
accatcctgtatgacatctggaacggtggcatcgacgaggaggacatccgcttcctatgt
gtcacttacgagcgactgctgcagcaggacaatggcatggactggcttaacgacacgctc
tgggtctaccatccctccaccagcctctcttcagctaagaaaaagaaacgggacgatggc
attcgtgagcacgtgacaggctgtgcccgcagcgagggcttctacaccatcgacaagaag
gacaagctcagatacctcaacagcagccgtgccagcaccgatgagccccctgcagacacc
cagggcatgagcatcccagcacagccccatgcctccacccgggcaggctcggagcgacgt
tcggagcagcgtcgcctgctgtcctccttcactggcagctgtgacagcgacctgctcaag
ttcaaccagctcaagttccggaagaaaaagctcaagttctgcaagagccacattcatgac
tggggcttgttcgccatggagcccatcgcggctgacgagatggtcatcgagtacgtgggc
cagaatatccgtcaggtgatcgcagacatgcgggagaagcgttatgaggacgagggcatc
gggagcagctacatgttccgggtggaccacgacaccatcatcgacgccaccaaatgcggc
aacttcgcgcgcttcatcaaccacagctgcaaccccaactgctatgccaaggtgatcacg
gtggagtcgcagaagaagatagtcatctactcgaagcagcacatcaacgtcaacgaggag
atcacctatgactacaagttccccatcgaggacgtcaagatcccctgcctctgcggctcc
gagaactgccggggcaccctcaactag

DBGET integrated database retrieval system