KEGG   Macaca mulatta (rhesus monkey): 703732Help
Entry
703732            CDS       T01028                                 

Definition
eukaryotic translation initiation factor 4E type 1B-like
Orthology
K03259  
translation initiation factor 4E
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    703732
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    703732
   04151 PI3K-Akt signaling pathway
    703732
   04150 mTOR signaling pathway
    703732
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    703732
Translation factors [BR:mcc03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    703732
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 246 aa AA seqDB search
MFAVEVSEAKGGIQEWKEEEKEKEKEEEAAERTPMGEEVPNSPRTLLSLRGKARMGIPME
VKLELHPLQNRWALWFFKNDRSRAWQDNLHLVTKVDSVEDFWALYSHIQLASKLSSGCDY
ALFKDGIEPMWEDSRNKRGGRWLVSLAKQQRHIELDRLWLETLLCLIGESFEEHSREVCG
AVVNIRTKGDKIAVWTREAENQAGVLHIGRVYKERLGLSPKTIIGYQAHADTATKSNSLA
KNKFVV
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctgttgaggtgagtgaagctaagggtggaatccaagagtggaaggaggaggag
aaggagaaggagaaggaggaggaagcagcagagaggacgcccatgggagaagaggttcca
aactctcccaggactttgctgtctttgagagggaaggcccggatggggatccccatggaa
gtcaagctggagctgcaccccctgcagaacaggtgggctctgtggttcttcaagaatgac
cgcagccgggcctggcaggacaacctgcacctggtcaccaaggtggacagtgtggaggac
ttctgggcgctctacagtcacatccagctggccagcaagctctcctccggctgtgactat
gccctgttcaaggatggcatcgagcccatgtgggaggacagcaggaataagcggggtggc
cgctggctggtcagcctggccaagcagcagcgccacattgagctggaccggctgtggctg
gagacgctgctgtgtctgatcggggagagctttgaggaacacagcagggaggtatgtggg
gctgtcgtcaacatccgcaccaagggggacaagatcgctgtgtggacgagggaggcagaa
aaccaggcgggcgtgctgcacattgggcgtgtatacaaagagcgcctgggcctctccccg
aagaccatcattgggtaccaggcccacgcagacacagccaccaagagcaactccctagcc
aagaacaagtttgtggtgtga

DBGET integrated database retrieval system