KEGG   Macaca mulatta (rhesus monkey): 703732Help
Entry
703732            CDS       T01028                                 

Gene name
EIF4E1B
Definition
(RefSeq) eukaryotic translation initiation factor 4E family member 1B
  KO
K03259  
translation initiation factor 4E
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Longevity regulating pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    703732 (EIF4E1B)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    703732 (EIF4E1B)
   04151 PI3K-Akt signaling pathway
    703732 (EIF4E1B)
   04150 mTOR signaling pathway
    703732 (EIF4E1B)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    703732 (EIF4E1B)
  Aging
   04211 Longevity regulating pathway - mammal
    703732 (EIF4E1B)
Messenger RNA biogenesis [BR:mcc03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     703732 (EIF4E1B)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     703732 (EIF4E1B)
Translation factors [BR:mcc03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    703732 (EIF4E1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
6
AA seq 246 aa AA seqDB search
MFAVEVSEAKGGIQEWKEEEKEKEKEEEAAERTPMGEEVPNSPRTLLSLRGKARMGIPME
VKLELHPLQNRWALWFFKNDRSRAWQDNLHLVTKVDSVEDFWALYSHIQLASKLSSGCDY
ALFKDGIEPMWEDSRNKRGGRWLVSLAKQQRHIELDRLWLETLLCLIGESFEEHSREVCG
AVVNIRTKGDKIAVWTREAENQAGVLHIGRVYKERLGLSPKTIIGYQAHADTATKSNSLA
KNKFVV
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctgttgaggtgagtgaagctaagggtggaatccaagagtggaaggaggaggag
aaggagaaggagaaggaggaggaagcagcagagaggacgcccatgggagaagaggttcca
aactctcccaggactttgctgtctctgagagggaaggcccggatggggatccccatggaa
gtcaagctggagctgcaccccctgcagaacaggtgggctctgtggttcttcaagaatgac
cgcagccgggcctggcaggacaacctgcacctggtcaccaaggtggacagtgtggaggac
ttctgggcgctctacagtcacatccagctggccagcaagctctcctccggctgtgactat
gccctgttcaaggatggcatcgagcccatgtgggaggacagcaggaataagcggggtggc
cgctggctggtcagcctggccaagcagcagcgccacattgagctggaccggctgtggctg
gagacgctgctgtgtctgatcggggagagctttgaggaacacagcagggaggtatgtggg
gctgtcgtcaacatccgcaccaagggggacaagatcgctgtgtggacgagggaggcagaa
aaccaggcgggcgtgctgcacattgggcgtgtatacaaagagcgcctgggcctctccccg
aagaccatcattgggtaccaggcccacgcagacacagccaccaagagcaactccctagcc
aagaacaagtttgtggtgtga

DBGET integrated database retrieval system