KEGG   Macaca mulatta (rhesus monkey): 703800Help
Entry
703800            CDS       T01028                                 

Gene name
MYST3
Definition
K(lysine) acetyltransferase 6A
Orthology
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     703800 (MYST3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 1905 aa AA seqDB search
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKS
IERFLKGQKDVSALFGGSAASGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGKE
CCESLSCLPPVSLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPS
CLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRM
PKGNTLAVEACSGELGVEAGWHMSACVGAFRGAKVKGGCGQRGTSHRSHSGQTCVVVVMC
KQLYWNWISTFTSGIRLEEQLAADGNTVKQQAVLQQKVGVTGPPDPQVRCPSVIEFGKYE
IHTWYSSPYPQEYSRLPKLYLCEFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISV
FEVDGNVSTIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHC
QQKYNVSCIMILPQYQRKGYGRFLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSV
ILECLYHQNDKQISIKKLSKLTGICPQDITSTLHHLRMLDFRSDQFVIIRREKLIQDHMA
KLQLNLRPVDVDPECLRWTPVIVSNSVVSEEEEEEAEEGENEEPQCQERELEISVGKSVS
RENKEQDSYSVESEKKPEVTAPVSSTRLNKQVLPRDSLPANSQPSRRGRWGRKNRKTQER
FGDKDSKLLLEETSSAPQEQYGECEEKSEATQEQYTESEEQLVASQEQLSQDGKPDLPKR
RLSEGVEPWRGQLKKSPEALKCRLTEGNERLPRRYSEGDRAVLRGFSESSEEEEEPESPR
SSSPPILTKPTLKRKKPFLHRRRRVRKRKHHNSSVVTETISETTEVLDEPFEDSDSERPM
PRLEPTFEIDEEEEEEDENELFPREYFHCLSSQDVLRCQSSSKRTSKDEEEDEESDDADD
TPILKPVSLLRKRDVKNSPLEPDTSTPLKKKKGWPKGKSRKPIHWKKRPGRKPGFKLSRE
IMPVSTQACVIEPVVPIPKAGRRPKIQESEETVEPKEDMPLTEERKEEEMQAEAEEAEEG
EEEDAASSEVPVASPADSSNSPETETKEPEVEEEEEKPRVSEEQRQSEEEQQELEEPEPE
EEEDAAAETAQNDDHDADDEDDGHLESTKKKELEEQPTREDVKEEPGVQESFLDANTQKS
REKIKDKEETELDSEEEQPSHDTSVVSEQMPGSEDDHEEDSHTKEELIELKEEEEIPHSE
LDLETVQAVQSLTQEESNEHESAYQDCEETLAACQTLQSYTQADEDPQMSMVEDCHASEH
NSPISSVQSHPSQSVRSVSSPNVPALESGYTQISPEQGSLSAPSMQNMETSPMMDVPSVS
DHSQQVVDSGFSDLGSIESTTENYENPSSYDSTMGGSICGNSSSQSSCSYGGLSSSSSLT
QSSCVVTQQMASMGSSCSMMQQSSVQPAANCSIKSPQSCVVERPPSNQQQQPPPPPPQQP
QPPPPQPQPAPQPPPPQQQPQQQPQPQPQQPPPPPPPQQQPPLSQCSMNNSFTPAPMIME
IPESGSTGNISIYERIPGDFGAGSYSQPSATFSLAKLQQLTNTIMDPHAMPYSHSPAVTS
YATSVSLSNTGLAQLAPSHPLAGTPQAQATMTPPPNLASTTMNLTSPLLQCNMSATNIGI
PHTQRLQGQMPVKGHISIRSKSAPLPSAAAHQQQLYGRSPSAVAMQAGPRALAVQRGMNM
GVNLMPTPAYNVNSMNMNTLNAMNSYRMTQPMMNSSYHSNPAYMNQTAQYPMQMQMGMMG
SQAYTQQPMQPNPHGNMMYTGPSHHSYMNAAGVPKQSLNGPYMRR
NT seq 5718 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaactcgcaaacccgctttatactgagtggattttggaggccatcaaaaaagtg
aaaaagcagaaacagcgtccttcagaagaaaggatatgcaatgctgtgtcttcatcccat
ggcttggatcgtaaaactgttttagaacaattggagttgagtgttaaagatggaacgatt
ttaaaagtctcaaataaaggactcaattcctataaagatcctgataatcctgggcgaata
gcacttcctaagcctcggaaccatggaaaattggataataaacaaaatgtggattggaat
aaactgataaagcgggcagttgagggcttggcagagtctggtggctcaactttgaaaagc
attgaacgttttttgaaaggtcagaaggatgtgtctgcgttatttggaggcagtgctgcc
tctggctttcaccagcagttacgattggctatcaaacgtgccattggccatggcagactc
cttaaagatggacctctttatcggctcaacactaaagcaaccaatgtggatgggaaagag
tgttgtgagtctctttcctgtttacctccagtgtcccttcttccacatgaaaaggataag
ccggttgctgaaccaatccccatctgtagtttctgtcttggtacaaaagaacaaaaccga
gaaaagaagccagaggaactcatctcctgtgccgattgtggcaacagtggccatccatcc
tgtttaaagttttcccctgaactaacggttcgagtgaaggccttacggtggcagtgcatt
gagtgtaaaacgtgcagctcctgtcgagatcaaggcaaaaatgcggataacatgctcttt
tgtgattcgtgtgaccgaggttttcacatggagtgttgtgatccaccactcacccgtatg
ccaaaaggaaacacccttgctgtggaggcttgctcaggggagctgggagtggaggcgggc
tggcacatgagcgcatgtgtaggagcgtttcgcggtgcaaaggttaagggcggatgtggg
cagaggggaacctcccacaggtcccattctggacagacgtgcgtagttgtggtgatgtgc
aaacagctgtactggaactggatatccactttcacgtcgggcatccgcctagaagagcag
ctggcagctgatgggaacaccgtcaaacaacaggcagtgttgcagcagaaagttggagtg
actggtccccctgatccacaagtccgctgtccctctgtcattgagtttgggaagtatgaa
attcacacctggtactcctccccatatcctcaagaatactcaaggcttcccaaattgtat
ctttgtgaattttgtctaaaatatatgaaaagtagaactattctgcagcagcacatgaag
aaatgtggttggttccatcctcctgccaatgagatttacagaaagaataatatttctgtc
tttgaggttgatgggaatgtgagtaccatttattgtcaaaacctgtgtctcttggcaaag
ttgtttcttgaccacaaaaccctctattatgatgtggagccatttcttttttatgtacta
acacagaatgatgtcaagggctgccaccttgttggctacttttctaaagaaaagcactgc
caacagaagtacaatgtttcctgtataatgattcttcctcaataccagcgtaagggctat
ggcaggtttctcatcgatttcagttatttgttatcaaagcgtgaaggccaagcagggtct
ccagagaaaccattatccgatctgggtcgtctttcctacatggcatattggaaaagtgta
atattggagtgcctttatcaccaaaatgacaagcagatcagcattaagaaattaagcaag
ttaactggaatctgccctcaagacatcacttccacactccaccacctacgaatgctggac
ttccgtagtgaccaatttgtgattatccgccgggaaaaacttatccaggatcacatggca
aagcttcagctgaatttgcgacctgtagatgtagatccagaatgtttgcgctggactcca
gtcatagtgtccaactctgtggtctcagaggaagaagaagaggaggctgaggaaggagaa
aacgaagagccacagtgccaggaaagagaattagagatcagtgtgggaaagtctgtgtct
cgtgagaacaaagaacaagattcttattcagtagaaagtgaaaagaaaccagaagttacg
gctccagtcagttctacacgtttgaacaaacaagtccttcctcgtgatagtcttcctgca
aatagccagccatctcggaggggccgctgggggaggaagaacagaaaaacccaggaacgc
ttcggtgataaagattctaaactgctcttggaagagacgtcttcagctcctcaggaacaa
tatggagaatgtgaggagaaatcagaagccacccaggaacaatacactgaaagtgaagaa
cagctggtggcctctcaggagcagctaagccaggatgggaaacctgaccttcccaaaaga
agactcagtgagggggttgagccctggcgaggacagctcaagaaaagccctgaggctctg
aagtgcagattaacagaaggaaatgagaggctgccccgccgctacagtgaaggtgacagg
gctgtcctcaggggcttcagtgagagcagcgaggaggaggaagagccggaaagccctcgg
tcaagctcgccaccaattctcacaaagcccacgctgaagcgaaagaaaccatttctccac
cgaaggaggagagtccgaaagcgcaaacaccacaatagcagtgtagtcacggaaactatt
tctgagaccactgaagtgttagatgaaccttttgaagattctgactccgagaggccaatg
ccaagattagaacccacatttgagatcgatgaagaagaggaggaagaggatgaaaatgaa
cttttccctagagaatacttccattgtttgtcttcgcaggatgtactcaggtgtcagtcc
tcttctaagaggacgtctaaagatgaagaagaagatgaagagtcagatgatgctgatgac
actcctatcctaaagccagtatctctcttgcgaaaacgtgatgtgaagaattctcctctt
gagccagatacatccacacctttgaaaaagaaaaagggatggcccaaaggcaagagtcgc
aaaccaatccactggaagaaaagacctggtcgaaaaccaggatttaagttgagtcgggaa
atcatgccagtttctactcaagcatgcgtcattgagcccgttgtccccattcctaaagct
ggacgtagacccaagatccaggagagtgaagaaactgttgagccaaaagaagacatgccc
ctaaccgaggagaggaaggaggaggagatgcaagcagaggcagaagaagctgaagagggt
gaggaagaggatgcagccagcagtgaagtcccagtagcctctccagcagacagcagcaat
agtcctgagaccgaaactaaggagcccgaggtggaggaggaagaagagaagccccgtgtc
tcagaggagcagaggcagtcagaggaggagcagcaggaattagaggagccagaaccagag
gaggaggaggatgcagctgcagagactgcccagaatgatgaccacgatgctgatgatgag
gatgatggccacctggagtccacaaagaaaaaggagctggaggaacagcccacaagggaa
gatgtcaaggaggagcctggtgttcaagagtcttttttagatgctaatacgcagaagagt
agggaaaagataaaggataaagaggaaactgagctggattccgaagaggagcaaccttcc
catgacacgtccgtggtgtcagagcagatgcctgggtctgaggacgaccacgaagaagac
tcccacactaaggaagagttaatcgaattaaaagaggaggaagagattcctcatagtgaa
ctggatctggaaactgtacaggcagtgcagtctttgactcaagaagaaagcaatgagcat
gagagcgcctaccaggactgtgaggaaactctcgcagcatgtcagactctgcagagttat
acccaggctgatgaggaccctcagatgtccatggttgaagactgtcatgcatcagaacat
aacagccctatctcctctgttcagtctcaccccagccagtcagtccgttcagtcagcagt
cccaacgtgcctgcccttgagagtggctacacccagatcagcccggaacaaggatccctg
tccgcaccctctatgcagaacatggagaccagccccatgatggatgtgccttccgtatca
gaccactctcagcaggtggtggacagcggcttcagtgacctgggcagcattgagagcacc
actgaaaactatgagaacccgagcagttatgactccacgatgggcggcagcatctgtggg
aacagctcttcccaaagcagctgctcctacggtgggctgtcgtcctccagcagcctcacc
cagagcagctgtgtggtcactcagcagatggccagcatgggcagcagctgcagcatgatg
cagcagagcagtgtccagcctgctgccaactgcagcatcaaatcacctcagagctgtgtg
gtggagaggcctcccagtaaccagcagcagcagccaccgccaccacctccacagcagccg
cagccaccgccgccacaaccacaaccagcaccacagcctccaccaccccagcagcagcca
cagcagcagccgcagcctcagccccagcagcctccgcccccaccccctccccagcagcag
cccccgctgtcacagtgtagtatgaataacagtttcaccccagctcctatgatcatggag
ataccagaatctggaagcactgggaacataagtatctatgagaggattccaggggatttt
ggtgctggcagctactctcaaccatcagccaccttcagcctagccaagctgcagcagctg
accaacaccattatggaccctcatgccatgccttatagccattctcctgctgtgacttcc
tatgcaaccagtgtttctctgtccaatacaggactggctcagctggctccgtctcatccc
ttagctgggactcctcaagcacaagccaccatgacgccacccccaaacttggcatccact
accatgaacctcacgtctcctctgctccagtgcaacatgtctgccaccaacattggcatt
cctcacacgcagagattgcaagggcaaatgccagtgaaggggcacatttccatccgctcc
aagtctgcaccactgccctctgcggctgctcaccagcagcagctgtatggccgcagcccg
tcggcagttgccatgcaggctggccctcgtgcactggctgttcagcgtggcatgaacatg
ggggttaatctgatgcctacccccgcctataatgtcaattccatgaatatgaacaccttg
aatgccatgaacagctatcgaatgacacagcccatgatgaacagcagttaccatagtaac
cctgcctacatgaaccagacagcacagtatcctatgcagatgcagatgggaatgatgggg
agccaggcctatacccagcagcctatgcagccaaaccctcatgggaacatgatgtacacg
ggcccctcccatcacagctacatgaacgctgctggcgtgcccaagcagtcactcaatgga
ccttacatgagaagatga

DBGET integrated database retrieval system