KEGG   Macaca mulatta (rhesus monkey): 703800Help
Entry
703800            CDS       T01028                                 

Gene name
KAT6A, MYST3
Definition
(RefSeq) K(lysine) acetyltransferase 6A
  KO
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Cellular Processes
  Cellular commiunity
   04550 Signaling pathways regulating pluripotency of stem cells
    703800 (KAT6A)
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     703800 (KAT6A)
Chromosome [BR:mcc03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    703800 (KAT6A)
   HAT complexes
    MOZ/MORF complex
     703800 (KAT6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
8
AA seq 2003 aa AA seqDB search
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKS
IERFLKGQKDVSALFGGSAASGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGKE
CCESLSCLPPVSLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPS
CLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRM
PKGMWICQICRPRKKGRKLLQKKAAQIKRRYANPIGRPKNRLKKQNTVSKGPFSKVRTGP
GRGRKRKMTLSSQSASSSSEEGYLERIDGLDFCRDSSVSLKFNKKTKGLIDGLTKFFTPS
PDGRKARGEVVDYSEQYRIRKRGNRKSSTSDWPTDNQDGWDGKQENEERLFGSQEIMTEK
DMELFRDIQEQALQKVGVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLC
EFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLF
LDHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGR
FLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLT
GICPQDITSTLHHLRMLDFRSDQFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTPVI
VSNSVVSEEEEEEAEEGENEEPQCQERELEISVGKSVSRENKEQDSYSVESEKKPEVTAP
VSSTRLNKQVLPRDSLPANSQPSRRGRWGRKNRKTQERFGDKDSKLLLEETSSAPQEQYG
ECEEKSEATQEQYTESEEQLVASQEQLSQDGKPDLPKRRLSEGVEPWRGQLKKSPEALKC
RLTEGNERLPRRYSEGDRAVLRGFSESSEEEEEPESPRSSSPPILTKPTLKRKKPFLHRR
RRVRKRKHHNSSVVTETISETTEVLDEPFEDSDSERPMPRLEPTFEIDEEEEEEDENELF
PREYFHCLSSQDVLRCQSSSKRTSKDEEEDEESDDADDTPILKPVSLLRKRDVKNSPLEP
DTSTPLKKKKGWPKGKSRKPIHWKKRPGRKPGFKLSREIMPVSTQACVIEPVVPIPKAGR
RPKIQESEETVEPKEDMPLTEERKEEEMQAEAEEAEEGEEEDAASSEVPVASPADSSNSP
ETETKEPEVEEEEEKPRVSEEQRQSEEEQQELEEPEPEEEEDAAAETAQNDDHDADDEDD
GHLESTKKKELEEQPTREDVKEEPGVQESFLDANTQKSREKIKDKEETELDSEEEQPSHD
TSVVSEQMPGSEDDHEEDSHTKEELIELKEEEEIPHSELDLETVQAVQSLTQEESNEHES
AYQDCEETLAACQTLQSYTQADEDPQMSMVEDCHASEHNSPISSVQSHPSQSVRSVSSPN
VPALESGYTQISPEQGSLSAPSMQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTE
NYENPSSYDSTMGGSICGNSSSQSSCSYGGLSSSSSLTQSSCVVTQQMASMGSSCSMMQQ
SSVQPAANCSIKSPQSCVVERPPSNQQQQPPPPPPQQPQPPPPQPQPAPQPPPPQQQPQQ
QPQPQPQQPPPPPPPQQQPPLSQCSMNNSFTPAPMIMEIPESGSTGNISIYERIPGDFGA
GSYSQPSATFSLAKLQQLTNTIMDPHAMPYSHSPAVTSYATSVSLSNTGLAQLAPSHPLA
GTPQAQATMTPPPNLASTTMNLTSPLLQCNMSATNIGIPHTQRLQGQMPVKGHISIRSKS
APLPSAAAHQQQLYGRSPSAVAMQAGPRALAVQRGMNMGVNLMPTPAYNVNSMNMNTLNA
MNSYRMTQPMMNSSYHSNPAYMNQTAQYPMQMQMGMMGSQAYTQQPMQPNPHGNMMYTGP
SHHSYMNAAGVPKQSLNGPYMRR
NT seq 6012 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaactcgcaaacccgctttatactgagtggattttggaggccatcaaaaaagtg
aaaaagcagaaacagcgtccttcagaagaaaggatatgcaatgctgtgtcttcatcccat
ggcttggatcgtaaaactgttttagaacaattggagttgagtgttaaagatggaacgatt
ttaaaagtctcaaataaaggactcaattcctataaagatcctgataatcctgggcgaata
gcacttcctaagcctcggaaccatggaaaattggataataaacaaaatgtggattggaat
aaactgataaagcgggcagttgagggcttggcagagtctggtggctcaactttgaaaagc
attgaacgttttttgaaaggtcagaaggatgtgtctgcgttatttggaggcagtgctgcc
tctggctttcaccagcagttacgattggctatcaaacgtgccattggccatggcagactc
cttaaagatggacctctttatcggctcaacactaaagcaaccaatgtggatgggaaagag
tgttgtgagtctctttcctgtttacctccagtgtcccttcttccacatgaaaaggataag
ccggttgctgaaccaatccccatctgtagtttctgtcttggtacaaaagaacaaaaccga
gaaaagaagccagaggaactcatctcctgtgccgattgtggcaacagtggccatccatcc
tgtttaaagttttcccctgaactaacggttcgagtgaaggccttacggtggcagtgcatt
gagtgtaaaacgtgcagctcctgtcgagatcaaggcaaaaatgcggataacatgctcttt
tgtgattcgtgtgaccgaggttttcacatggagtgttgtgatccaccactcacccgtatg
ccaaaaggcatgtggatatgtcaaatatgtcgacctaggaaaaaaggacgaaaacttcta
caaaagaaggcagcacagataaaacggcgttatgctaatccaataggacgtccaaaaaac
aggttaaagaaacaaaacacggtatcaaaaggtcccttcagcaaagttcgaactggccct
ggaaggggtaggaaacgaaaaatgactctttccagccaatcagcatcatcatcatcagaa
gaaggatatttagaacggatagatggcttggacttctgcagagatagcagtgtctccttg
aagttcaacaagaaaaccaaagggctcattgatggccttaccaaattttttaccccttcc
cctgatggtcggaaagctcgtggggaagtggtggactactctgagcaatatcgaatcaga
aagaggggcaacaggaaatcaagcacttcagattggcccacagacaatcaggatggctgg
gatggcaaacaagaaaatgaggagcgactttttgggagccaggaaatcatgactgagaaa
gatatggaattatttcgtgatatccaagaacaagcactgcagaaagttggagtgactggt
ccccctgatccacaagtccgctgtccctctgtcattgagtttgggaagtatgaaattcac
acctggtactcctccccatatcctcaagaatactcaaggcttcccaaattgtatctttgt
gaattttgtctaaaatatatgaaaagtagaactattctgcagcagcacatgaagaaatgt
ggttggttccatcctcctgccaatgagatttacagaaagaataatatttctgtctttgag
gttgatgggaatgtgagtaccatttattgtcaaaacctgtgtctcttggcaaagttgttt
cttgaccacaaaaccctctattatgatgtggagccatttcttttttatgtactaacacag
aatgatgtcaagggctgccaccttgttggctacttttctaaagaaaagcactgccaacag
aagtacaatgtttcctgtataatgattcttcctcaataccagcgtaagggctatggcagg
tttctcatcgatttcagttatttgttatcaaagcgtgaaggccaagcagggtctccagag
aaaccattatccgatctgggtcgtctttcctacatggcatattggaaaagtgtaatattg
gagtgcctttatcaccaaaatgacaagcagatcagcattaagaaattaagcaagttaact
ggaatctgccctcaagacatcacttccacactccaccacctacgaatgctggacttccgt
agtgaccaatttgtgattatccgccgggaaaaacttatccaggatcacatggcaaagctt
cagctgaatttgcgacctgtagatgtagatccagaatgtttgcgctggactccagtcata
gtgtccaactctgtggtctcagaggaagaagaagaggaggctgaggaaggagaaaacgaa
gagccacagtgccaggaaagagaattagagatcagtgtgggaaagtctgtgtctcgtgag
aacaaagaacaagattcttattcagtagaaagtgaaaagaaaccagaagttacggctcca
gtcagttctacacgtttgaacaaacaagtccttcctcgtgatagtcttcctgcaaatagc
cagccatctcggaggggccgctgggggaggaagaacagaaaaacccaggaacgcttcggt
gataaagattctaaactgctcttggaagagacgtcttcagctcctcaggaacaatatgga
gaatgtgaggagaaatcagaagccacccaggaacaatacactgaaagtgaagaacagctg
gtggcctctcaggagcagctaagccaggatgggaaacctgaccttcccaaaagaagactc
agtgagggggttgagccctggcgaggacagctcaagaaaagccctgaggctctgaagtgc
agattaacagaaggaaatgagaggctgccccgccgctacagtgaaggtgacagggctgtc
ctcaggggcttcagtgagagcagcgaggaggaggaagagccggaaagccctcggtcaagc
tcgccaccaattctcacaaagcccacgctgaagcgaaagaaaccatttctccaccgaagg
aggagagtccgaaagcgcaaacaccacaatagcagtgtagtcacggaaactatttctgag
accactgaagtgttagatgaaccttttgaagattctgactccgagaggccaatgccaaga
ttagaacccacatttgagatcgatgaagaagaggaggaagaggatgaaaatgaacttttc
cctagagaatacttccattgtttgtcttcgcaggatgtactcaggtgtcagtcctcttct
aagaggacgtctaaagatgaagaagaagatgaagagtcagatgatgctgatgacactcct
atcctaaagccagtatctctcttgcgaaaacgtgatgtgaagaattctcctcttgagcca
gatacatccacacctttgaaaaagaaaaagggatggcccaaaggcaagagtcgcaaacca
atccactggaagaaaagacctggtcgaaaaccaggatttaagttgagtcgggaaatcatg
ccagtttctactcaagcatgcgtcattgagcccgttgtccccattcctaaagctggacgt
agacccaagatccaggagagtgaagaaactgttgagccaaaagaagacatgcccctaacc
gaggagaggaaggaggaggagatgcaagcagaggcagaagaagctgaagagggtgaggaa
gaggatgcagccagcagtgaagtcccagtagcctctccagcagacagcagcaatagtcct
gagaccgaaactaaggagcccgaggtggaggaggaagaagagaagccccgtgtctcagag
gagcagaggcagtcagaggaggagcagcaggaattagaggagccagaaccagaggaggag
gaggatgcagctgcagagactgcccagaatgatgaccacgatgctgatgatgaggatgat
ggccacctggagtccacaaagaaaaaggagctggaggaacagcccacaagggaagatgtc
aaggaggagcctggtgttcaagagtcttttttagatgctaatacgcagaagagtagggaa
aagataaaggataaagaggaaactgagctggattccgaagaggagcaaccttcccatgac
acgtccgtggtgtcagagcagatgcctgggtctgaggacgaccacgaagaagactcccac
actaaggaagagttaatcgaattaaaagaggaggaagagattcctcatagtgaactggat
ctggaaactgtacaggcagtgcagtctttgactcaagaagaaagcaatgagcatgagagc
gcctaccaggactgtgaggaaactctcgcagcatgtcagactctgcagagttatacccag
gctgatgaggaccctcagatgtccatggttgaagactgtcatgcatcagaacataacagc
cctatctcctctgttcagtctcaccccagccagtcagtccgttcagtcagcagtcccaac
gtgcctgcccttgagagtggctacacccagatcagcccggaacaaggatccctgtccgca
ccctctatgcagaacatggagaccagccccatgatggatgtgccttccgtatcagaccac
tctcagcaggtggtggacagcggcttcagtgacctgggcagcattgagagcaccactgaa
aactatgagaacccgagcagttatgactccacgatgggcggcagcatctgtgggaacagc
tcttcccaaagcagctgctcctacggtgggctgtcgtcctccagcagcctcacccagagc
agctgtgtggtcactcagcagatggccagcatgggcagcagctgcagcatgatgcagcag
agcagtgtccagcctgctgccaactgcagcatcaaatcacctcagagctgtgtggtggag
aggcctcccagtaaccagcagcagcagccaccgccaccacctccacagcagccgcagcca
ccgccgccacaaccacaaccagcaccacagcctccaccaccccagcagcagccacagcag
cagccgcagcctcagccccagcagcctccgcccccaccccctccccagcagcagcccccg
ctgtcacagtgtagtatgaataacagtttcaccccagctcctatgatcatggagatacca
gaatctggaagcactgggaacataagtatctatgagaggattccaggggattttggtgct
ggcagctactctcaaccatcagccaccttcagcctagccaagctgcagcagctgaccaac
accattatggaccctcatgccatgccttatagccattctcctgctgtgacttcctatgca
accagtgtttctctgtccaatacaggactggctcagctggctccgtctcatcccttagct
gggactcctcaagcacaagccaccatgacgccacccccaaacttggcatccactaccatg
aacctcacgtctcctctgctccagtgcaacatgtctgccaccaacattggcattcctcac
acgcagagattgcaagggcaaatgccagtgaaggggcacatttccatccgctccaagtct
gcaccactgccctctgcggctgctcaccagcagcagctgtatggccgcagcccgtcggca
gttgccatgcaggctggccctcgtgcactggctgttcagcgtggcatgaacatgggggtt
aatctgatgcctacccccgcctataatgtcaattccatgaatatgaacaccttgaatgcc
atgaacagctatcgaatgacacagcccatgatgaacagcagttaccatagtaaccctgcc
tacatgaaccagacagcacagtatcctatgcagatgcagatgggaatgatggggagccag
gcctatacccagcagcctatgcagccaaaccctcatgggaacatgatgtacacgggcccc
tcccatcacagctacatgaacgctgctggcgtgcccaagcagtcactcaatggaccttac
atgagaagatga

DBGET integrated database retrieval system