KEGG   Macaca mulatta (rhesus monkey): 704416Help
Entry
704416            CDS       T01028                                 

Gene name
PFN4
Definition
profilin family, member 4
Orthology
K05759  
profilin
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    704416 (PFN4)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    704416 (PFN4)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    704416 (PFN4)
Exosome [BR:mcc04147]
 Exosomal proteins
  Proteins found in most exosomes
   704416 (PFN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
13
AA seq 129 aa AA seqDB search
MSHLQSLLLDTLLGTKHVDSAALIKIQERSLCVASPGFNVMPSDVRTLVNGFAKNPLQTR
REGLYFKEKDYRCVRADEYSLYAKNENAGVVVVKTHLYLLVATYTEGMYPSVCVEATESL
GDYLRKKGS
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgagccatttgcagagcttattgttagacaccctcttgggaaccaagcatgtggacagt
gcagccctcatcaaaatccaggagcggagcctgtgtgtagcatcaccaggttttaatgta
atgcccagtgatgtccgaacactggtgaatggatttgccaagaaccctttgcaaacccga
agagaaggattgtatttcaaggaaaaggattacagatgtgtccgggcagatgaatattct
ctttatgccaaaaatgagaacgctggtgtggttgtggtgaagacccatctgtatcttctg
gtggcaacttacactgagggcatgtatcctagcgtctgtgtggaagccacagagagcctg
ggagactacctaagaaaaaaaggaagttga

DBGET integrated database retrieval system