KEGG   Macaca mulatta (rhesus monkey): 704452Help
Entry
704452            CDS       T01028                                 

Gene name
HIST1H2BM
Definition
histone cluster 1, H2bm
Orthology
K11252  
histone H2B
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    704452 (HIST1H2BM)
  Immune diseases
   05322 Systemic lupus erythematosus
    704452 (HIST1H2BM)
  Substance dependence
   05034 Alcoholism
    704452 (HIST1H2BM)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   704452 (HIST1H2BM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 126 aa AA seqDB search
MPEPLKSAPASKKGSKKAINKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaaccactgaaatctgctccagcctctaaaaagggctccaagaaggccattaac
aaggctcagaagaaggatggaaagaagcggaaacgcagccgcaaggaaagctactccgtg
tacgtgtacaaggtgctgaagcaagtccaccccgacaccggcatttcctccaaggctatg
gggattatgaactcctttgtcaacgacatcttcgagcgtatcgccggagaagcgtcacgc
ctggcgcattataacaagcgctcgaccatcacttcgagggagattcagacggccgtgcgc
ctactgctgcccggggaattggccaagcatgccgtgtcggagggcaccaaggccgtcacc
aagtataccagctccaagtga

DBGET integrated database retrieval system