KEGG   Macaca mulatta (rhesus monkey): 704467Help
Entry
704467            CDS       T01028                                 

Gene name
HDAC3
Definition
histone deacetylase 3 (EC:3.5.1.98)
Orthology
K11404  
histone deacetylase 3 [EC:3.5.1.98]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Thyroid hormone signaling pathway
Alcoholism
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    704467 (HDAC3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    704467 (HDAC3)
  Substance dependence
   05034 Alcoholism
    704467 (HDAC3)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     704467 (HDAC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 428 aa AA seqDB search
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCR
FHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNN
KICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEA
FYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVI
NQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTV
RNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQ
TIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDN
DKESDVEI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaccgtggcctatttctacgaccccgacgtgggcaacttccactacggagct
ggacaccctatgaagccccatcgcttggcattgacccatagcctggtcctgcattacggt
ctctataagaagatgatcgtcttcaagccataccaggcctcccagcatgacatgtgccgc
ttccactccgaggactacattgacttcctgcagagagtcagccccaccaatatgcaaggc
ttcaccaagagtcttaatgccttcaacgtaggcgatgactgcccagtgtttcccgggctc
tttgagttctgctcgcgttacacaggcgcatctctgcaaggagcaacccagctgaacaac
aagatctgtgatattgccattaactgggctggtggtctgcaccatgccaagaagtttgag
gcctctggcttctgctatgtcaacgacattgtgattggcatcctggagctgctcaagtac
caccctcgggtgctttacattgatattgacatccaccatggtgacggggttcaggaagct
ttctacctcactgaccgggtcatgacggtgtccttccacaaatacggaaattacttcttc
cctggcacaggtgacatgtatgaagtcggggcagagagtggccgctactactgtctgaat
gtgcccctgcgggatggcattgatgaccagagttacaagcaccttttccagccggttatc
aaccaggtagtggacttctaccaacccacgtgcattgtgctccagtgtggagctgactct
ctgggctgtgatcgattgggctgctttaacctcagcatccgagggcatggggaatgcgtc
gaatatgtcaagagcttcaatatccctctactggtgctgggtggtggtggttatactgtc
cgaaatgttgcccgttgctggacatatgagacatcgctgctggtagaagaggccattagt
gaggagcttccctatagtgaatacttcgagtactttgccccagacttcacacttcatcca
gatgtcagcactcgcatcgagaatcagaactcacgccagtatctggaccagatccgccag
acaatctttgaaaacctgaagatgctgaaccatgcacctagtgtccagattcatgacgtg
cctgcagacctcctgacctatgacaggactgatgaggctgatgcagaggagaggggtcct
gaggagaactatagcaggccagaggcacccaatgagttctatgatggagaccatgacaat
gacaaggaaagtgatgtggagatttaa

DBGET integrated database retrieval system