KEGG   Macaca mulatta (rhesus monkey): 704676Help
Entry
704676            CDS       T01028                                 

Gene name
RNASE1, RAC1
Definition
ribonuclease, RNase A family, 1 (pancreatic) (EC:3.1.27.5)
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     704676 (RNASE1)
Messenger RNA biogenesis [BR:mcc03019]
 Eukaryotic Type
  mRNA degradation factors
   Other degradation factors
    RNases
     704676 (RNASE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 152 aa AA seqDB search
MALDKSVILLPLLVLVLLVLGCLGRESRAKKFQRQHMDSGSSPSSNSTYCNQMMKRRSMT
HGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQTNCFKSKSSMHITDCRLTNGSRYPNCA
YRTSPKERHIIVACEGSPHVPVHFDASVEDST
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggctctggataagtctgtcatcctgctccctctgcttgtcctggtgctgctggtgctg
ggctgcctgggcagggaatcccgggccaagaaattccagcggcagcacatggactcaggc
agttcccccagcagcaactccacctactgcaaccaaatgatgaagcgccggagtatgacg
cacgggcggtgcaaaccagtgaacacctttgtgcatgagcccctggtagatgtccagaat
gtctgcttccaggaaaaggtcacctgcaagaacgggcagaccaactgcttcaagagcaag
tccagcatgcacatcacagactgccgcctgacaaacggctccaggtaccccaactgtgca
taccggaccagcccgaaggagagacacatcattgtggcctgtgaagggagcccacatgtg
ccagtccacttcgatgcttctgtggaggactcaacctaa

DBGET integrated database retrieval system