KEGG   Macaca mulatta (rhesus monkey): 704743Help
Entry
704743            CDS       T01028                                 

Gene name
SMUG1
Definition
single-strand-selective monofunctional uracil-DNA glycosylase 1
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    704743 (SMUG1)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     704743 (SMUG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
11
AA seq 270 aa AA seqDB search
MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLSAELSQLQFSESVGVIYNPLEY
AWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSIVRDWLGIGGPVLTPPQE
HPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHCFVHNLCPLLFLAPSGRNLTPA
ELPAKQREQLLRICDAALCRQVQLLGVRLVVGVGRLAEQRARRALAGLMPEVQVEGLLHP
SPRNPQANKGWEAVAKERLNELGLLPLLLK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgccccaggctttcctgctggggtccatccatgagcctgcaggtgccctgatggagccc
cagccctgccctggaagcttggctgagagcttcctggaggaggagcttcggctcagtgct
gagctgagccagctgcagttttcggagtctgtgggcgtcatctacaatcccttggagtat
gcatgggagccacatcgcaactacgtgactcgctactgccagggccccaaggaagtgctc
ttcctgggcatgaaccctggaccttttggcatggcccagactggggtgccctttggggaa
gtaagcatagtccgggactggttgggcattggggggcctgtgctgacccctccccaagag
catcctaaacgaccagtgctgggactggagtgtccacagtcagaagtgagtggtgcccga
ttctggggctttttccggaacctctgtggacagcctgaggtcttcttccatcactgtttt
gtccacaatctatgccctctgcttttcctggctcccagcgggcgcaacctcacccctgct
gagctgcctgccaagcagcgagaacagcttcttcggatctgtgatgcagccctctgccgg
caggtgcagctgctgggggtgcggctggtggtgggagttgggcgactggcagagcagcgg
gcacgacgggctctggcaggcctgatgccagaggtccaggtggaagggctcctgcatccc
tctccccgtaacccacaggccaacaagggctgggaggcagtggccaaggaaagattgaat
gagctggggctgctgccactgctgttgaaatga

DBGET integrated database retrieval system