KEGG   Macaca mulatta (rhesus monkey): 704808Help
Entry
704808            CDS       T01028                                 

Gene name
MYST4
Definition
K(lysine) acetyltransferase 6B
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     704808 (MYST4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 1893 aa AA seqDB search
MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQLELSVQDGSV
LKVTNKGLASYKDPDNPGRFSSVKPGTFPKSTKGSRGSCNDLRNVDWNKLLRRAIEGLEE
PNGSSLKNIEKYLRSQSDLTSTTNNPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGSLD
GKGAPQYPSAFPSSLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCADC
GSSGHPSCLKFCPELTTNVKALRWQCIECKTCSACRVQGRNADNMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIKRRYAKPIGRPKNKLKQRLLSVTSDE
GSMNAFTGRGSPGRGQKTKVCTTPSSGHAASGKDSSSRLAVTDPTRPGATTKITTTSTYI
SASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQSCTSHVLA
TDTEIKINIKQESADVNVIGNKDVVTEEDLDVFKQAQELSWEKIECESGVEDCGRYPSVI
EFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANEIYR
RKDLSVFEVDGNMSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLVGYF
SKEKLCQQKYNVSCIMIMPQHQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRLSYL
AYWKSVILEYLYHHHERHISIKAISRATGMCPHDIATTLQHLHMIDKRDGRFVIIRREKL
ILSHMEKLKTCSRANELDPDSLRWTPILISNAAVSEEEREAEKEAERLMEQASCWEKEEQ
EVLSTRANSRQSPAKVQSKNKYLHSPESRPVTGERGQLLELSKESSEEEEEEEEDEEEED
EEEEEEEEDEEEEEEEEEEEEEEEEEENIQSSPPRLTKPQSVAIKRKRPFVLKKKRGRKR
RRINSSVTTETISETTEVLNEPFDNSDEERPMPQLEPTCEIEVEEDGRKPVLRKAFQHQP
GKKRQTEEEEGKDNHCFKNADPCRNNMNDDSSNLKEGSKDNPELLKCKQAWPKGTKRGLS
KWRQNKERKTGFKLNLYTPPETPLEPDEQVTVEEQKETSEGKTSPTPISIEEEAKEAGEA
LLPQEENRRQETCAPVSPNTSPGEKPEDDLIKPEEEEEEEEEEEEEEGEEEEEEGGNVEK
DPDGAKSQEKEEPEISPEKEDSACLDDHEEEEEEDEEPSHNEDHDADDEDDSHMESAEVE
KEELPRESFKEVLENQEAFLDLNVQPSHSNPEVLMDCGVDLTASCNSEPKELAGDPEAVP
ESDEEPPPGEQAQKQDQKNSKEVDTEFKEGNPATMEIDSETVQAVQSLTQESSEQDDTFQ
DCAETQEACRSLQNYTRADQSPQIATTLDDCQQSDHSSPVSSVHSHPGQSVRSVNSPSVP
ALENSYAQISPDQSAISVPSLQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENY
ENPSSYDSTMGGSICGNGSSQNSCSYSNLTSSSLTQSSCAVTQQMSNISGSCSMLQQTSI
SSPPTCSVKSPQGCVVERPPSSSQQLAQCSMAANFTPPMQLAEIPETGNANIGLYERMGQ
SDFGAGHYPQPSATFSLAKLQQLTNTLIDHSLPYSHSAAVTSYANSASLSTPLSNTGLVQ
LSQSPHSVPGGPQAQATMTPPPNLTPPPMNLPPPLLQRNMAASNIGISHSQRLQTQIASK
GHVSMRTKSASLSPAAATHQSQIYGRSQTVAMQGPARTLTMQRGMNMSVNLMPAPAYNVN
SVNMNMNTLNAMNGYSMSQPMMNSGYHSNHGYMNQTPQYPMQMQMGMMGTQPYAQQPMQT
PPHGNMMYTAPGHHGYMNTGMSKQSLNGSYMRR
NT seq 5682 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgcaaacccactttatacagagtggattcttgaagctatacagaaaata
aaaaagcaaaagcaaaggccctctgaagagagaatctgccatgcggtcagtacttcccat
gggttggataagaagacagtctctgaacagctggaactcagtgttcaggatggctcagtt
ctcaaagtcaccaacaaaggccttgcctcctataaggacccagacaaccctgggcgcttt
tcatcagttaaaccaggcacttttcctaagtcaaccaaggggtctagaggatcatgtaac
gatctccgcaatgtggattggaataaacttttaaggagagcaattgaaggacttgaggag
ccaaatggctcctccctgaagaacatagagaagtatctcagaagtcaaagtgatctcacg
agcaccaccaacaacccagcctttcagcagcggctgcgactgggggccaaacgtgctgtg
aataatgggaggttactgaaagatggaccgcagtacagggtcaattatgggagcttagat
ggcaaaggggcacctcagtatcccagtgctttcccatcctcgctcccacctgtcagcctt
ctaccccatgagaaagaccagccacgtgctgatcccattccaatatgtagcttctgtttg
gggactaaagaatcaaatcgtgaaaagaaaccagaagaactcctctcttgtgcagattgt
ggcagtagtggacacccatcctgtttgaaattttgtcctgaattaacaacaaatgtaaag
gccttaaggtggcagtgcatcgaatgcaagacatgcagtgcctgtagagtccaaggcaga
aatgctgataatatgcttttttgtgattcctgtgatagaggattccatatggaatgctgt
gacccaccactttccagaatgccaaaagggatgtggatttgccaagtctgcagaccaaag
aaaaagggaagaaaactacttcatgagaaagctgcacaaataaaacgacgatatgcaaaa
cccattggacgaccgaaaaataaattaaagcaacgattgttgtctgtaaccagtgatgaa
ggatccatgaatgcattcacaggaagggggtcacctggtaggggtcaaaagactaaagtc
tgtaccacaccttcatctggtcatgctgcatctgggaaggactcaagcagcagattggct
gttacagaccccactcggcctggtgccaccaccaaaatcaccaccacctccacctacatt
tctgcctctacacttaaagttaacaagaaaaccaaagggctcattgatggccttactaag
ttttttacaccatcacctgatggtcgcagatcacgaggtgaaataatagacttttcaaag
cactatcgtccaaggaaaaaggtctctcagaaacagtcatgcacttctcatgtgttggct
acagatactgaaataaaaataaacatcaaacaagaaagtgcagatgtaaatgtgattgga
aacaaggatgtcgttactgaagaggatttggatgtttttaagcaggcccaggaactttct
tgggagaaaatagagtgtgagagtggggtggaagactgtggccggtacccttctgtgatt
gaatttggtaaatacgaaatccaaacctggtactcctcgccttacccacaggaatatgca
agattaccaaagctttacctgtgtgaattctgtcttaaatatatgaaaagtaaaaatatt
ttgctaagacactccaagaagtgcggatggtttcatcctccagcaaatgaaatttaccgg
aggaaagacctttcagtatttgaggttgatgggaatatgagcaaaatttattgccaaaac
ctttgcttgttagccaagctcttcctggaccacaaaacgttgtattatgatgtcgagcca
ttccttttttatgtccttacaaaaaatgatgaaaagggctgtcatctggttggatacttc
tctaaggaaaagctttgccagcagaagtataatgtctcctgcataatgatcatgccccag
caccaaaggcaaggatttggacggtttctcattgatttcagctatttgctttctagaaga
gaaggccaagcagggtctcctgaaaagcctctctccgatctgggccgtctctcctacctg
gcatattggaagagcgtcatcttagagtatctctaccaccaccatgagaggcacatcagc
atcaaagcaattagcagagcgacgggcatgtgcccacatgacattgccaccactctgcag
cacctccacatgatcgacaagagagatggcagatttgtcatcattagacgggaaaagttg
atactgagccacatggaaaagctgaaaacctgttccagagccaatgaacttgatccagac
agtctgaggtggaccccaattttaatttctaatgctgcagtgtctgaagaagagcgagaa
gctgagaaagaggctgagcggctaatggaacaagctagctgctgggagaaggaggaacaa
gaagtcctgtcaactagagctaacagtaggcaatcacctgcaaaagtacaatcgaaaaat
aaatatttgcattccccggagagccggccagtcacaggggagcgagggcagctgctggag
ctctctaaagagagcagtgaagaagaagaggaggaggaggaggacgaggaggaggaggac
gaggaggaagaggaggaggaagaggacgaagaggaggaagaagaggaagaagaagaggaa
gaagaagaagaagaagaagaaaatattcaaagctctcccccgagattgacgaaaccacag
tcagttgccataaagagaaagaggccttttgtactaaagaagaaaaggggtcgtaaacgc
aggaggatcaacagcagtgtaacaacagagaccatttcagagacgacagaagtactgaat
gagcccttcgacaactcagatgaagagaggccaatgccacagctggagcctacctgcgag
attgaagtggaggaagatggcaggaagccagtcttgagaaaagcattccaacatcagcct
gggaagaaaagacaaacagaggaagaggaaggaaaagacaatcattgctttaagaatgct
gacccttgtagaaacaatatgaatgatgattcgagtaacttgaaagaaggcagtaaagac
aatcccgaacttctaaagtgcaaacaagcgtggccaaaaggaacaaagcgtggtctgtct
aagtggaggcaaaacaaagagaggaagaccggatttaaactgaatttgtacaccccacca
gaaacacccctggagcctgatgagcaggtaacagtggaagaacagaaggagacttcagaa
ggaaaaaccagccccactcccatcagcattgaggaggaggccaaggaagctggggaagcc
ctgctgcctcaagaggaaaacagaaggcaagaaacatgtgcccctgtaagtccaaataca
tcaccaggtgaaaaaccagaagatgatctcatcaaacctgaggaggaggaggaggaggag
gaagaagaggaagaagaggaaggggaagaagaagaagaagaaggaggaaatgtagaaaaa
gatccagatggtgctaaaagccaagaaaaagaggaaccagaaatctccccggaaaaagaa
gactctgcatgtttggatgatcatgaagaggaggaggaagaggacgaagagccatctcac
aacgaggaccatgatgccgatgacgaggatgacagccacatggagtctgccgaagtggag
aaggaagagctgcccagagaaagctttaaagaagtactggaaaaccaggaggctttttta
gaccttaatgtgcagcctagtcactcgaacccagaggtcttaatggactgtggcgtcgac
ctgacagcctcttgtaacagtgagcccaaggagcttgctggggaccctgaagccgtaccc
gaatctgacgaggagccacccccaggagaacaggcacagaagcaggaccaaaagaacagc
aaagaagtcgatacagagttcaaagagggaaacccagcaaccatggaaatcgactctgag
accgtccaggcagttcagtctttgacccaggagagcagtgaacaggatgacacctttcag
gattgtgccgagactcaagaggcctgtagaagcctacagaactacacccgtgcagaccaa
agtccacagattgccaccactctggacgattgccaacagtcagaccacagtagcccggtt
tcatccgtccactcccatcctggccagtccgtacgttctgtcaatagcccaagtgtccct
gctttggaaaacagctatgcccaaatcagcccagatcaaagtgccatctcagtgccatct
ctgcagaacatggaaaccagtcccatgatggatgtcccatcagtttcagatcattcacag
caagtcgtagacagtggatttagtgacctgggcagtatcgagagcacaactgagaactac
gaaaacccaagcagctacgattctactatgggaggcagcatctgtggaaatggctcttca
cagaacagctgctcctatagcaacctcacctccagcagtctgacacagagcagctgtgct
gtcacccagcagatgtccaacatcagcgggagctgcagcatgctgcagcaaaccagcatc
agctcccctccgacctgcagtgtcaagtctcctcaaggctgtgtggtggagaggcctccg
agcagcagccagcagctggctcagtgcagcatggctgctaacttcactccacccatgcag
ctggctgaaatccccgagacgggcaacgccaacattggcttatacgagcgaatgggtcag
agtgattttggggctgggcattacccacagccgtcagccaccttcagccttgccaaactg
cagcagttaactaatacacttattgatcattcattgccttacagccattccgctgctgtg
acttcctatgcaaacagtgcctctttgtccacaccattaagtaacacagggcttgttcag
ctttctcagtctccacactccgtccctgggggaccccaagcacaagctaccatgacccca
ccccccaacctgactcctcctccaatgaatctgccgccgcctcttttgcaacgaaacatg
gctgcatcaaatattggcatctctcacagccaaagactgcaaacccagattgccagcaag
ggccacgtctccatgagaaccaagtcagcgtctctgtcaccagccgctgccacccatcag
tcacaaatctatgggcgctcccagactgtagccatgcagggtcctgcacggactttaacg
atgcaaagaggcatgaacatgagtgtgaacctgatgccagccccagcctacaatgtcaac
tctgtgaacatgaacatgaacactctcaatgccatgaatgggtacagcatgtcccagcca
atgatgaacagtggctaccacagcaatcatggctatatgaatcaaacgccccaataccct
atgcagatgcagatgggcatgatgggcacccagccatatgcccagcagccaatgcagacc
cccccccacggtaacatgatgtacacggcccctggacatcacggctacatgaacacaggc
atgtccaaacagtctctcaatggctcctacatgagaaggtag

DBGET integrated database retrieval system