KEGG   Macaca mulatta (rhesus monkey): 704926Help
Entry
704926            CDS       T01028                                 

Gene name
GART
Definition
(RefSeq) phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase
  KO
K11787  
phosphoribosylamine--glycine ligase / phosphoribosylglycinamide formyltransferase / phosphoribosylformylglycinamidine cyclo-ligase [EC:6.3.4.13 2.1.2.2 6.3.3.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Antifolate resistance
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    704926 (GART)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    704926 (GART)
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    704926 (GART)
Enzymes [BR:mcc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     704926 (GART)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.1  phosphoribosylformylglycinamidine cyclo-ligase
     704926 (GART)
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.13  phosphoribosylamine---glycine ligase
     704926 (GART)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 1010 aa AA seqDB search
MAARVLIIGSGGREHTLAWKLAQSHHVKQVLVAPGNAGTACSEKISNNAISTSDHTALAQ
FCKEEKIEFVVVGPEAPLAAGIVGNLTSAGVRCFGPTAEAAQLESSKRFAKEFMDRHGIP
TAQWKAFTKPEEACSFIMSADFPALVVKASGLAAGKGVIVAKSKEEACKAVQEIMQEKAF
GAAGETIVIEELLDGEEVSCLCFTDGKTVAPMPPAQDHKRLLEGDGGPNTGGMGAYCPAP
QVSNDLLLKIKDTVLQRTVDGMQQEGTPYTGILYAGIMLTKDGPKVLEFNCRFGDPECQV
ILPLLKSDLYEVIQSTLNGLLCTSLPVWLENHTALTVVMASKGYPGDYTKGVEITGFSEA
QALGLEVFHAGTALKNGKVVTHGGRVLAVTAIRENLVSALEEAKKGLAAIKFEGAIYRKD
IGFRAIAFLQQPRGLTYKESGVDIAAGNTLVKKIQPLAEATSRSGCKVDLGGFAGLFDLK
AAGFKDPLLASGTDGVGTKLKIAQLCNKHDTIGQDLVAMCVNDILAQGAEPLFFLDYFSC
GKLDLSVTEAVVAGIAKACGKAGCALLGGETAEMPDMYPPGEYDLAGFAVGAMERDQKLP
HLERITEGDVVVGIASSGLHSNGFSLVRKIVAKSFLQYSSPAPDGCGDQTLGDLLLTPTR
IYSHSLLPILRSGHVKAFAHITGGGLLENIPRVLPEKLGVDLDAQTWRIPKVFSWLQQEG
QLSEEEMARTFNCGVGAALVVSKEQTEQILRDIQQHKEEAWVIGSVVARAEGSPCVKVKN
LIESMQINGSVLKNGSLKNHFSFEKKKARVAVLISGTGSNLQALIDSTREPNSSAQIDVV
ISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDNAIDLVLEEFSIDIVCLAGFMRILS
GPFVRKWNGKMLNIHPSLLPCFKGSNAHEQALETGVTVTGCTVHFVAEEVDAGQIILQEA
VPVKRGDTVATLSERVKLAEHKTFPAALQLVASGTVQLGENGKICWVKEE
NT seq 3033 nt NT seq  +upstreamnt  +downstreamnt
atggcagcccgagtacttataattggcagtggaggaagggaacatacgctggcctggaaa
cttgcacagtctcatcatgtcaaacaagtgttggttgccccaggaaacgcaggcactgcc
tgctctgaaaagatttcaaataacgccatctcaaccagtgaccacactgcccttgctcaa
ttctgcaaagaggagaaaattgaattcgtagttgttggaccagaagcacctctggctgct
gggattgttgggaacctgacgtctgcaggagtgcgatgctttggcccaacagcagaagcg
gctcagttagagtccagcaaaaggtttgccaaagagtttatggacagacatggaatccca
actgcgcaatggaaggctttcaccaaacctgaagaggcctgcagcttcattatgagtgca
gacttccctgctttggttgtgaaggccagtggtcttgcggctggaaaaggggtgattgtt
gcaaagagcaaagaagaggcctgcaaagctgtacaagagatcatgcaggagaaagccttt
ggggcagccggagaaacaattgtcattgaagaacttcttgacggagaagaggtgtcttgt
ctgtgcttcactgatggcaagactgtggcccccatgccaccggcgcaggaccataagcga
ttactggaaggagatggcggccctaacacagggggaatgggagcctattgtccggcccct
caggtttctaatgatctattactaaaaattaaagatactgttcttcagaggacagtggat
ggcatgcagcaagagggtactccatatacaggtattctctatgctggaataatgctgacc
aaggatggcccaaaagttctagagtttaattgccgttttggtgatccagagtgccaagta
atcctcccacttcttaaaagtgatctttatgaagtgattcagtccaccttaaatggactg
ctctgcacatctctgcctgtttggctagaaaaccacaccgccctaactgttgtcatggca
agtaaaggttatcctggagactacaccaagggtgtagagataacagggttttccgaggct
caagctctaggactggaggtgttccacgcaggcactgcccttaaaaatggcaaagtagta
actcatgggggtagagttcttgcagtcacagccatccgggaaaatctcgtatcagctctc
gaggaagccaagaaaggactagcagctataaagtttgagggagcaatttataggaaagac
attggctttcgtgccatagctttcctccagcagcccaggggtttgacttacaaggaatct
ggagtagacattgcagctggaaatacgctggtcaagaaaattcagcctttagcagaagcc
acttccagatcaggctgtaaagttgatcttggaggttttgctggtctttttgatttaaaa
gcagctggtttcaaagatccccttctggcctctggaacagatggcgttggaactaaacta
aagattgcccagctgtgcaacaaacatgataccattggtcaagatttggtagcaatgtgt
gttaatgatattctggcacaaggagcagagcccctcttcttccttgattacttttcctgt
ggaaaacttgacctcagtgtaactgaagccgttgttgctggaattgctaaagcttgtgga
aaagctggatgtgctcttcttggaggtgaaacagcagaaatgcctgacatgtatccccct
ggagagtatgacctagctgggtttgccgttggtgccatggagcgagatcagaaactccct
cacctggaaagaatcaccgagggtgatgttgttgttggaatagcttcatctggtcttcat
agcaatggatttagccttgtgaggaagatcgtggcaaaatctttcctccagtactcctct
ccagcacctgatggttgtggtgaccagactttaggggacttacttctcacgccaaccaga
atctacagccattcactgttacctatcctacgttcaggacatgtcaaagcgtttgcccat
attactggtggaggattactagagaacatccccagagtcctccctgagaaacttggggta
gatttagatgcccagacctggaggatccccaaagtcttctcatggttacagcaggaagga
caactctctgaggaagagatggccagaacatttaactgtggggttggcgctgcccttgtg
gtatcaaaggagcagacagagcagattctgagggatatccagcagcacaaggaagaagcc
tgggtgattggcagtgtggttgcacgagctgaaggttctccatgtgtgaaagtcaagaat
ctaattgaaagcatgcaaataaatgggtcagtgttgaagaatggctccctgaaaaatcat
ttctcttttgaaaaaaaaaaggccagagtggctgtcttaatatctggaacaggatcgaac
ctgcaagcacttatagacagtactcgggaaccaaatagctctgcacaaattgatgttgtt
atctccaacaaagccgcagtagctgggttagataaagcggaaagagctggtattcccact
agagtaattaatcataaactgtataaaaatcgtgtagaatttgacaatgcaattgaccta
gtccttgaagagttctccatagacatagtctgtcttgcaggattcatgagaattctttct
ggcccctttgtccgaaagtggaatggaaaaatgctcaatatccacccatccttgctccct
tgttttaagggttcgaatgcccatgagcaagccctggaaaccggagtcacagttactggg
tgtactgtacactttgtagctgaagaggtagatgctggacaaattattttgcaagaagct
gttcccgtgaagaggggtgatactgttgcaactctttctgaaagagtaaaattagcagaa
cataaaacatttcctgcagccctccagttggtggccagtggaactgtacagcttggagaa
aatggcaagatctgttgggttaaagaggaatga

DBGET integrated database retrieval system