KEGG   Macaca mulatta (rhesus monkey): 704926Help
Entry
704926            CDS       T01028                                 

Gene name
GART
Definition
phosphoribosylglycinamide formyltransferase, phosphoribosylglycinamide synthetase, phosphoribosylaminoimidazole synthetase
Orthology
K11787  
phosphoribosylamine--glycine ligase / phosphoribosylglycinamide formyltransferase / phosphoribosylformylglycinamidine cyclo-ligase [EC:6.3.4.13 2.1.2.2 6.3.3.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Purine metabolism
One carbon pool by folate
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    704926 (GART)
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    704926 (GART)
Enzymes [BR:mcc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.2  phosphoribosylglycinamide formyltransferase
     704926 (GART)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.1  phosphoribosylformylglycinamidine cyclo-ligase
     704926 (GART)
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.13  phosphoribosylamine---glycine ligase
     704926 (GART)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 1067 aa AA seqDB search
MAARVLIIGSGGREHTLAWKLAQSHHVKQVLVAPGNAGTACSEKISNNAISTSDHTALAQ
FCKEEKIEFVVVGPEAPLAAGIVGNLTSAGVRCFGPTAEAAQLESSKRFAKEFMDRHGIP
TAQWKAFTKPEEACSFIMSADFPALVVKASGLAAGKGVIVAKSKEEACKAVQEIMQEKAF
GAAGETIVIEELLDGEEVSCLCFTDGKTVAPMPPAQDHKRLLEGDGGPNTGGMGAYCPAP
QVSNDLLLKIKDTVLQRTVDGMQQEGTPYTGILYAGIMLTKDGPKVLEFNCRFGDPECQV
ILPLLKSDLYEVIQSTLNGLLCTSLPVWLENHTALTVVMASKGYPGDYTKGVEITGFSEA
QALGLEVFHAGTALKNGKVVTHGGRVLAVTAIRENLVSALEEAKKGLAAIKFEGAIYRKD
IGFRAIAFLQQPRGLTYKESGVDIAAGNTLVKKIQPLAEATSRSGCKVDLGGFAGLFDLK
AAGFKDPLLASGTDGVGTKLKIAQLCNKHDTIGQDLVAMCVNDILAQGAEPLFFLDYFSC
GKLDLSVTEAVVAGIAKACGKAGCALLGGETAEMPDMYPPGEYDLAGFAVGAMERDQKLP
HLERITEGDVVVGIASSGLHSNGFSLVRKIVAKSFLQYSSPAPDGCGDQTLGDLLLTPTR
IYSHSLLPILRSGHVKAFAHITGGGLLENIPRVLPEKLGVDLDAQTWRIPKVFSWLQQEG
QLSEEEMARTFNCGVGAALVVSKEQTEQILRDIQQHKEEAWVIGSVVARAEGSPCVKVKN
LIESMQINGSVLKNGSLKNHFSFEKKKARVAVLISGTGSNLQALIDSTREPNSSAQIDVV
ISNKAAVAGLDKAERAGIPTRVINHKLYKNRVEFDNAIDLVLEEFSIDIIIFHLLNKYSE
PSFTCLEAKENDSVCPERKSPSSLRKQTIARRWQGGGYCQKTHTIYVTAFSPKAWTASCL
CMCAHRKMLNIHPSLLPCFKGSNAHEQALETGVTVTGCTVHFVAEEVDAGQIILQEAVPV
KRGDTVATLSERVKLAEHKTFPAALQLVASGTVQLGENGKICWVKEE
NT seq 3204 nt NT seq  +upstreamnt  +downstreamnt
atggcagcccgagtacttataattggcagtggaggaagggaacatacgctggcctggaaa
cttgcacagtctcatcatgtcaaacaagtgttggttgccccaggaaacgcaggcactgcc
tgctctgaaaagatttcaaataacgccatctcaaccagtgaccacactgcccttgctcaa
ttctgcaaagaggagaaaattgaattcgtagttgttggaccagaagcacctctggctgct
gggattgttgggaacctgacgtctgcaggagtgcgatgctttggcccaacagcagaagcg
gctcagttagagtccagcaaaaggtttgccaaagagtttatggacagacatggaatccca
actgcgcaatggaaggctttcaccaaacctgaagaggcctgcagcttcattatgagtgca
gacttccctgctttggttgtgaaggccagtggtcttgcggctggaaaaggggtgattgtt
gcaaagagcaaagaagaggcctgcaaagctgtacaagagatcatgcaggagaaagccttt
ggggcagccggagaaacaattgtcattgaagaacttcttgacggagaagaggtgtcttgt
ctgtgcttcactgatggcaagactgtggcccccatgccaccggcgcaggaccataagcga
ttactggaaggagatggcggccctaacacagggggaatgggagcctattgtccggcccct
caggtttctaatgatctattactaaaaattaaagatactgttcttcagaggacagtggat
ggcatgcagcaagagggtactccatatacaggtattctctatgctggaataatgctgacc
aaggatggcccaaaagttctagagtttaattgccgttttggtgatccagagtgccaagta
atcctcccacttcttaaaagtgatctttatgaagtgattcagtccaccttaaatggactg
ctctgcacatctctgcctgtttggctagaaaaccacaccgccctaactgttgtcatggca
agtaaaggttatcctggagactacaccaagggtgtagagataacagggttttccgaggct
caagctctaggactggaggtgttccacgcaggcactgcccttaaaaatggcaaagtagta
actcatgggggtagagttcttgcagtcacagccatccgggaaaatctcgtatcagctctc
gaggaagccaagaaaggactagcagctataaagtttgagggagcaatttataggaaagac
attggctttcgtgccatagctttcctccagcagcccaggggtttgacttacaaggaatct
ggagtagacattgcagctggaaatacgctggtcaagaaaattcagcctttagcagaagcc
acttccagatcaggctgtaaagttgatcttggaggttttgctggtctttttgatttaaaa
gcagctggtttcaaagatccccttctggcctctggaacagatggcgttggaactaaacta
aagattgcccagctgtgcaacaaacatgataccattggtcaagatttggtagcaatgtgt
gttaatgatattctggcacaaggagcagagcccctcttcttccttgattacttttcctgt
ggaaaacttgacctcagtgtaactgaagccgttgttgctggaattgctaaagcttgtgga
aaagctggatgtgctcttcttggaggtgaaacagcagaaatgcctgacatgtatccccct
ggagagtatgacctagctgggtttgccgttggtgccatggagcgagatcagaaactccct
cacctggaaagaatcaccgagggtgatgttgttgttggaatagcttcatctggtcttcat
agcaatggatttagccttgtgaggaagatcgtggcaaaatctttcctccagtactcctct
ccagcacctgatggttgtggtgaccagactttaggggacttacttctcacgccaaccaga
atctacagccattcactgttacctatcctacgttcaggacatgtcaaagcgtttgcccat
attactggtggaggattactagagaacatccccagagtcctccctgagaaacttggggta
gatttagatgcccagacctggaggatccccaaagtcttctcatggttacagcaggaagga
caactctctgaggaagagatggccagaacatttaactgtggggttggcgctgcccttgtg
gtatcaaaggagcagacagagcagattctgagggatatccagcagcacaaggaagaagcc
tgggtgattggcagtgtggttgcacgagctgaaggttctccatgtgtgaaagtcaagaat
ctaattgaaagcatgcaaataaatgggtcagtgttgaagaatggctccctgaaaaatcat
ttctcttttgaaaaaaaaaaggccagagtggctgtcttaatatctggaacaggatcgaac
ctgcaagcacttatagacagtactcgggaaccaaatagctctgcacaaattgatgttgtt
atctccaacaaagccgcagtagctgggttagataaagcggaaagagctggtattcccact
agagtaattaatcataaactgtataaaaatcgtgtagaatttgacaatgcaattgaccta
gtccttgaagagttctccatagacataataatatttcatcttctgaataaatattcggaa
ccttcctttacttgtttagaagcaaaagagaatgattccgtatgtcccgaaaggaagagt
ccatcctctctcaggaaacagaccattgccagacgttggcaaggaggaggttattgccag
aaaacacatactatctatgttactgccttctccccaaaagcctggactgcatcctgtttg
tgtatgtgtgcacacagaaaaatgctcaatatccacccatccttgctcccttgttttaag
ggttcgaatgcccatgagcaagccctggaaaccggagtcacagttactgggtgtactgta
cactttgtagctgaagaggtagatgctggacaaattattttgcaagaagctgttcccgtg
aagaggggtgatactgttgcaactctttctgaaagagtaaaattagcagaacataaaaca
tttcctgcagccctccagttggtggccagtggaactgtacagcttggagaaaatggcaag
atctgttgggttaaagaggaatga

DBGET integrated database retrieval system