KEGG   Macaca mulatta (rhesus monkey): 705191Help
Entry
705191            CDS       T01028                                 

Gene name
USP2
Definition
ubiquitin specific peptidase 2
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     705191 (USP2)
Peptidases [BR:mcc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   705191 (USP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 605 aa AA seqDB search
MSQLSSTLKRYTESARYTDAHYSKSGYGAYTPSSYGANLAASLLEKEKFGFKPVPASSFL
TRPRTYGPSSILDYDRGRPLLRPNITGGGKRAESQTRGTERPSGSGLSGGSGFPYGVSNN
CLSYLPMNAYDQGVTLTQKSDSQSDLARDFSSLRTSDNYRIDPGNLGRSPMLARTRKELC
TLQGLYQAASRPEYLVDYLENYGRKGSASQVPSQTPPSRVPEILSPTFRPIGRYTLWEKG
KGQAPGPSRSSSPGRDSMNSKSAQGLAGLRNLGNTCFMNSILQCLSNTRELRDYCLQRLY
MRDLHHSSNAHTALMEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFVGYNQQDAQE
FLRFLLDGLHNEVNRVTLRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQLK
SSLTCTDCGYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMRLFTKEDVLDGDEKPTCCRCR
GRKRCIKKFSIQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRDLDLREFASENTNHAV
YNLYAVSNHSGTTMGGHYTAYCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYELAS
PPSRM
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagctctcctccaccctgaagcgctacacagaatcagcccgctacacagatgcc
cactattccaagtcgggctatggtgcctataccccctcctcctatggggccaacctggct
gcctccttactggagaaagagaaatttggtttcaagccggtccccgccagcagcttcctc
acccgtccccgtacctatggcccctcctccatcctggactatgaccggggccgccccctg
ctgagacccaacatcactgggggaggtaagcgggcagagagccagacccggggtactgag
cggccttcaggcagtggcctcagtgggggcagtggattcccttatggagtgagcaacaac
tgcctcagctacctgcccatgaatgcctatgaccagggggtgaccctaacccagaagtcg
gacagccaatcagacctggcccgggatttctccagcctccggacctcagataactaccgg
atagaccccgggaacctgggtcgcagccccatgctggcccggacgcgcaaggagctctgc
accctgcaggggctctaccaggcagccagccgccctgagtacctggtggactacctggag
aactatggtcgcaagggcagtgcatctcaggtgccctcccagacccctccttcacgagtc
cctgaaatcctcagcccaaccttccgacccattggccgctacacgctgtgggagaaggga
aagggtcaggcccctgggcccagccgctccagctccccggggagagacagcatgaattct
aagagtgcccagggtctggctggtcttcgaaaccttgggaacacgtgcttcatgaactca
attctgcagtgcctgagcaacacccgagagttgagagattactgcctccagaggctctac
atgcgggacctgcaccacagcagcaatgcacacacagccctcatggaagagtttgcaaaa
ctaattcagaccatatggacttcatcccccaatgatgtggtgagcccatctgagttcaag
acccagatccagagatacgcaccgcgctttgtcggctataatcagcaggacgctcaggag
ttccttcgctttcttctggatgggctccataatgaggtgaaccgagtgacactgaggcct
aagtccaaccctgagaacctcgatcatcttcctgatgacgagaaaggccgacagatgtgg
agaaaatatctagaacgggaagacagtaggatcggggatctctttgttgggcagctaaag
agctccctgacgtgtacagattgtggttactgttctacagtcttcgaccccttctgggac
ctctcactgcccattgctaagcgaggttatcctgaggtgacattaatggattgcatgagg
ctcttcaccaaagaggatgtgcttgatggagatgaaaagccaacatgctgtcgctgccga
ggcagaaaacggtgtataaagaagttctccatccagaggttcccaaagatcttggtgctc
catctgaagcggttctcagaatccaggatccgaaccagcaagctcacaacatttgtgaac
ttccccctaagagacctggacttaagagaatttgcctcagaaaacaccaaccatgctgtt
tacaacctgtatgctgtgtccaatcactccggaaccaccatgggtggccactatacagcc
tactgtcgcagcccagggacaggcgagtggcacactttcaacgactccagcgtcactccc
atgtcctccagccaagtgcgcaccagcgacgcctacctgctcttctacgaactggccagc
ccgccctcccgaatgtag

DBGET integrated database retrieval system