KEGG   Macaca mulatta (rhesus monkey): 705191Help
Entry
705191            CDS       T01028                                 

Gene name
USP2
Definition
ubiquitin specific peptidase 2
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.1.2.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 605 aa AA seqDB search
MSQLSSTLKRYTESARYTDAHYSKSGYGAYTPSSYGANLAASLLEKEKFGFKPVPASSFL
TRPRTYGPSSILDYDRGRPLLRPNITGGGKRAESQTRGTERPSGSGLSGGSGFPYGVSNN
CLSYLPMNAYDQGVTLTQKSDSQSDLARDFSSLRTSDNYRIDPGNLGRSPMLARTRKELC
TLQGLYQAASRPEYLVDYLENYGRKGSASQVPSQTPPSRVPEILSPTFRPIGRYTLWEKG
KGQAPGPSRSSSPGRDSMNSKSAQGLAGLRNLGNTCFMNSILQCLSNTRELRDYCLQRLY
MRDLHHSSNAHTALMEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFVGYNQQDAQE
FLRFLLDGLHNEVNRVTLRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQLK
SSLTCTDCGYCSTVFDPFWDLSLPIAKRGYPEVTLMDCMRLFTKEDVLDGDEKPTCCRCR
GRKRCIKKFSIQRFPKILVLHLKRFSESRIRTSKLTTFVNFPLRDLDLREFASENTNHAV
YNLYAVSNHSGTTMGGHYTAYCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYELAS
PPSRM
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagctctcctccaccctgaagcgctacacagaatcagcccgctacacagatgcc
cactattccaagtcgggctatggtgcctataccccctcctcctatggggccaacctggct
gcctccttactggagaaagagaaatttggtttcaagccggtccccgccagcagcttcctc
acccgtccccgtacctatggcccctcctccatcctggactatgaccggggccgccccctg
ctgagacccaacatcactgggggaggtaagcgggcagagagccagacccggggtactgag
cggccttcaggcagtggcctcagtgggggcagtggattcccttatggagtgagcaacaac
tgcctcagctacctgcccatgaatgcctatgaccagggggtgaccctaacccagaagtcg
gacagccaatcagacctggcccgggatttctccagcctccggacctcagataactaccgg
atagaccccgggaacctgggtcgcagccccatgctggcccggacgcgcaaggagctctgc
accctgcaggggctctaccaggcagccagccgccctgagtacctggtggactacctggag
aactatggtcgcaagggcagtgcatctcaggtgccctcccagacccctccttcacgagtc
cctgaaatcctcagcccaaccttccgacccattggccgctacacgctgtgggagaaggga
aagggtcaggcccctgggcccagccgctccagctccccggggagagacagcatgaattct
aagagtgcccagggtctggctggtcttcgaaaccttgggaacacgtgcttcatgaactca
attctgcagtgcctgagcaacacccgagagttgagagattactgcctccagaggctctac
atgcgggacctgcaccacagcagcaatgcacacacagccctcatggaagagtttgcaaaa
ctaattcagaccatatggacttcatcccccaatgatgtggtgagcccatctgagttcaag
acccagatccagagatacgcaccgcgctttgtcggctataatcagcaggacgctcaggag
ttccttcgctttcttctggatgggctccataatgaggtgaaccgagtgacactgaggcct
aagtccaaccctgagaacctcgatcatcttcctgatgacgagaaaggccgacagatgtgg
agaaaatatctagaacgggaagacagtaggatcggggatctctttgttgggcagctaaag
agctccctgacgtgtacagattgtggttactgttctacagtcttcgaccccttctgggac
ctctcactgcccattgctaagcgaggttatcctgaggtgacattaatggattgcatgagg
ctcttcaccaaagaggatgtgcttgatggagatgaaaagccaacatgctgtcgctgccga
ggcagaaaacggtgtataaagaagttctccatccagaggttcccaaagatcttggtgctc
catctgaagcggttctcagaatccaggatccgaaccagcaagctcacaacatttgtgaac
ttccccctaagagacctggacttaagagaatttgcctcagaaaacaccaaccatgctgtt
tacaacctgtatgctgtgtccaatcactccggaaccaccatgggtggccactatacagcc
tactgtcgcagcccagggacaggcgagtggcacactttcaacgactccagcgtcactccc
atgtcctccagccaagtgcgcaccagcgacgcctacctgctcttctacgaactggccagc
ccgccctcccgaatgtag

DBGET integrated database retrieval system