KEGG   Macaca mulatta (rhesus monkey): 705193Help
Entry
705193            CDS       T01028                                 

Gene name
ALAD
Definition
(RefSeq) aminolevulinate dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00860  Porphyrin and chlorophyll metabolism
mcc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    705193 (ALAD)
Enzymes [BR:mcc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     705193 (ALAD)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   705193 (ALAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-GeneID: 705193
NCBI-ProteinID: XP_001101576
Ensembl: ENSMMUG00000031965
UniProt: F7GY51
Position
15
AA seq 339 aa AA seqDB search
MPLCPLAHAMQPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPIASLP
GVARYGVNRLEEMLRPLVEEGLRCVLIFGIPSRVPKDERGSAADSEESPAIEAIHLLRKT
FPNLLVACDICLCPYTSHGHCGLLSENGAFRAEESRQRLAEVALAYAKAGCQVVAPSDMM
DGRVEAIKEALMAHGLGNRVSVMSYSAKFASCFYGPFRDAAQSSPAFGDRRCYQLPPGAR
GLALRAVDRDVREGADVLMVKPGMPYLDIVREVKDKHPDLPLAVYHVSGEFAMLWHGAQA
GAFDLKAAVLEAMTAFRRAGADIIITYYTPQLLQWLKKE
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgtgcccactggcccatgccatgcagccccagtccgttctgcacagcggctac
ttccacccactgcttcgggcctggcagacagccaccaccaccctcaatgcctccaacctc
atctaccccatctttgtcacggatgttcctgatgacatacagcctatcgccagcctccca
ggagtggccaggtatggtgtgaaccggctggaagagatgctgaggcccttggtggaagag
ggcctacgctgtgtcttgatctttggcatccccagcagagttcccaaggacgagcggggt
tccgcagctgactccgaggagtccccagctattgaggcaatccatctgttgaggaagacc
ttccccaacctcctggtggcctgtgacatctgcctatgtccctacacctcccatggtcac
tgcgggctcctgagtgaaaatggagcattccgggctgaggagagccgccagcggctagct
gaggtagcactggcatatgccaaggcaggatgtcaggtggtagccccgtcagacatgatg
gatggacgtgtggaagccatcaaggaggccctgatggcacatggacttggcaacagggta
tcagtgatgagctacagtgccaagtttgcttcctgtttctatggccctttccgggacgca
gctcagtcaagcccagcttttggggaccgccgctgctaccagctgccccctggagcacga
ggcctggccctccgagctgtggaccgggatgtacgggaaggagctgacgtactcatggtg
aagccgggaatgccctacctggacatcgtgcgggaggtaaaggacaagcaccccgacctc
cctctcgccgtgtaccatgtctctggagagtttgccatgctgtggcacggagcccaggct
ggggcatttgatctcaaggctgccgtactggaggccatgactgccttccgcagagcaggt
gctgacatcatcatcacctactacacaccccagctgctgcagtggctgaagaaggaatga

DBGET integrated database retrieval system