KEGG   Macaca mulatta (rhesus monkey): 705195Help
Entry
705195            CDS       T01028                                 

Gene name
MAP2K3
Definition
mitogen-activated protein kinase kinase 3
Orthology
K04432  
mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
Rap1 signaling pathway
Toll-like receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Amyotrophic lateral sclerosis (ALS)
Toxoplasmosis
Influenza A
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    705195 (MAP2K3)
   04010 MAPK signaling pathway
    705195 (MAP2K3)
   04668 TNF signaling pathway
    705195 (MAP2K3)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    705195 (MAP2K3)
   04664 Fc epsilon RI signaling pathway
    705195 (MAP2K3)
  Endocrine system
   04912 GnRH signaling pathway
    705195 (MAP2K3)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    705195 (MAP2K3)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    705195 (MAP2K3)
  Infectious diseases
   05164 Influenza A
    705195 (MAP2K3)
   05169 Epstein-Barr virus infection
    705195 (MAP2K3)
   05145 Toxoplasmosis
    705195 (MAP2K3)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     705195 (MAP2K3)
Protein kinases [BR:mcc01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   705195 (MAP2K3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
16
AA seq 347 aa AA seqDB search
MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVD
FTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgcccgcctcaagccagcccgccagcatgccccagtccaaaggaaaatccaag
aggaagaaggatctacggatatcctgcatgtccaagccacccgcgcctaaccccacaccc
ccccggaacctggactcccggaccttcatcaccattggagacagaaactttgaggtggag
gctgatgacttggtgaccatctcggaactgggccgtggagcctatggggtggtggagaag
gtgcggcacgcccagagcggcaccatcatggccgtgaagcggatccgggccactgtgaac
tcacaggagcagaagcggctgctcatggacctggacatcaacatgcgcacggtcgactgc
ttctacactgtcaccttctacggggcactgttcagagagggagacgtgtggatctgcatg
gagctcatggacacatccctggacaagttctaccggaaggtgctggataaaaacatgaca
attccagaggacatccttggggagattgctgtgtctatcgtgcgggctctggagcatctg
cacagcaagctgtcggtgatccacagagatgtgaagccctccaatgtccttatcaacaag
gagggccatgtgaagatgtgtgacttcggcatcagtggttacttggtggactctgtggcc
aagacgatggatgccggctgcaagccctacatggcccctgagaggatcaacccggagctg
aaccagaagggctacaatgtcaagtccgacgtctggagcctgggcattaccatgattgag
atggccatcctgcggttcccttacgagtcctgggggaccccgttccagcagctgaagcag
gtggtggaggagccgtccccccagctcccagccgaccgtttctcccccgagtttgtggac
ttcactgctcagtgcctgaggaagaaccccgcagagcgtatgagctacctggagctgatg
gagcaccccttcttcaccttgcacaaaaccaagaagacagacatcgctgccttcgtgaag
gagatcctgggcgaagactcatag

DBGET integrated database retrieval system