KEGG   Macaca mulatta (rhesus monkey): 705233Help
Entry
705233            CDS       T01028                                 

Gene name
LTC4S
Definition
leukotriene C4 synthase
Orthology
K00807  
leukotriene-C4 synthase [EC:4.4.1.20]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mcc00590]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 150 aa AA seqDB search
MKDEVALLATVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYF
PLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYASSAQLRLAPLYASARALWLLVA
LAALGLLAHFLPAALRAALLGRLRTLLPWA
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacgaggtagctctactggccaccgtcaccctcctgggagtcctgctgcaagcc
tacttctccctgcaggtgatctcggcgcgcagggccttccgcgtgtcgccgccgctcacc
accggcccacccgagttcgagcgcgtctaccgagcccaggtgaactgcagcgagtacttc
ccgctattcctcgccacgctctgggtcgccggcatcttctttcatgaaggggcggcggcg
ctgtgcggcctggtctacctgttcgcgcgcctccgctacttccagggctacgccagctcc
gcgcagctcaggctggcacccctgtacgcgagcgcgcgcgccctctggctgctggtggcg
ctggctgcgctcggcctgctcgcccacttcctcccggccgcgctgcgcgccgcgctcctc
ggacggctgcggacgttgctgccgtgggcctga

DBGET integrated database retrieval system