KEGG   Macaca mulatta (rhesus monkey): 705413Help
Entry
705413            CDS       T01028                                 

Gene name
THBS1
Definition
thrombospondin 1
Orthology
K16857  
thrombospondin 1
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Rap1 signaling pathway
p53 signaling pathway
Phagosome
PI3K-Akt signaling pathway
TGF-beta signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Proteoglycans in cancer
MicroRNAs in cancer
Bladder cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    705413 (THBS1)
   04350 TGF-beta signaling pathway
    705413 (THBS1)
   04151 PI3K-Akt signaling pathway
    705413 (THBS1)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    705413 (THBS1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    705413 (THBS1)
  Cell growth and death
   04115 p53 signaling pathway
    705413 (THBS1)
  Cellular commiunity
   04510 Focal adhesion
    705413 (THBS1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    705413 (THBS1)
   05205 Proteoglycans in cancer
    705413 (THBS1)
   05219 Bladder cancer
    705413 (THBS1)
  Infectious diseases
   05144 Malaria
    705413 (THBS1)
Heparan sulfate/heparin binding proteins [BR:mcc00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  705413 (THBS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 1085 aa AA seqDB search
MGLAWGLGVLFLLHVWGTLLALERKDHSGQVFSVVSNGKAGTLDLSLTVQGKQHVVSVEE
ALLATGQWKSITLFVQEDRAQLYIDCEKMENAELDVPIQSVFTRDLASIARLRIAKGGVN
DNFQGVLQNVRFVFGTTPEDILRNKGCSSSTSVLLTLDNNVVNGSSPAIRTNYIGHKTKD
LQAICGISCDELSSMVLELRGLRTIVTTLQDSIRKVTEENKELANELRRPPLCYHNGVQY
RNNEEWTVDSCTECRCQNSVTICKKVSCPIMPCSNATVPDGECCPRCWPSDSADDGWSPW
SEWTSCSTSCGNGIQQRGRSCDSLNNRCEGSSVQTRTCHIQECDKRFKQDGGWSHWSPWS
SCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARETKACKKDACPINGGWGPWSPWDICS
VTCGGGVQKRSRLCNNPTPQFGGKDCIGDVTENQICNKQDCPIDGCLSNPCFAGVKCTSY
PDGSWKCGACPPGYSGNGIQCTDVDECKEVPDACFNHNGEHRCKNTDPGYNCLPCPPRFT
GSQPFGQGVEYATANKQVCKPRNPCTDGTHDCNKNAKCNYLGHYSDPMYRCECKPGYAGN
GIICGEDTDLDGWPNEDLVCVANATYHCKKDNCPNLPNSGQEDYDKDGIGDACDDDDDND
KIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYNHNPDQADTDSNGEGDACAADIDGDG
ILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEHNPDQLDSDSDRIGDTCDNNQDIDED
GHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDNDGIPDDRDNCRLVPNPDQKDSDGDG
RGDACKDDFDHDNVPDIDDICPENVDISETDFRRFQMIPLDPKGTSQNDPNWVVRHQGKE
LVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDDDYAGFVFGYQSSSRFYVVMWKQVTQ
SYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNALWHTGNTPGQVRTLWHDPRHIGWKDF
TAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYDKTYAGGRLGLFVFSQEMVFFSDLKY
ECRDP
NT seq 3258 nt NT seq  +upstreamnt  +downstreamnt
atggggctggcctggggactaggcgtcctgttcctgttgcatgtgtggggcacgctgctg
gccctggagcggaaagaccactctggccaggtcttcagcgtggtgtccaacggcaaggcg
ggcaccctggacctcagcctgaccgtccaaggaaagcagcacgtggtgtctgtggaagaa
gctctcctggcaaccggccagtggaagagcatcaccctgtttgtgcaggaagacagggcc
cagctgtacatcgactgtgaaaagatggagaatgccgagctggacgtccccatccaaagc
gtcttcaccagagacctggccagcatcgccagactccgcatcgcaaaggggggcgtcaat
gacaatttccagggggtgctgcagaatgtgaggttcgtctttggaaccacaccagaagac
atcctcaggaacaaaggctgctccagctctaccagtgtcctcctcacccttgacaacaac
gtggtgaatggttccagccctgccatccgcactaactacattggccacaagacaaaggat
ctgcaagccatctgcggcatctcctgtgatgagctgtccagcatggtcctggaactcagg
ggcctgcgcaccatcgtgaccacgctgcaggacagcatccgcaaagtgactgaagagaac
aaagagttggccaatgagctgaggcggcctcccctgtgctatcacaacggagttcagtac
agaaataacgaggaatggactgttgatagctgcaccgagtgtcgctgtcagaactcagtt
accatctgcaaaaaggtgtcctgtcccatcatgccctgctccaatgccacagttcccgat
ggagaatgctgtcctcgctgttggcccagcgactctgcggacgatggctggtctccatgg
tctgagtggacgtcctgttctacaagctgtggcaacggaattcagcagcgtggccgctcc
tgtgatagcctcaacaaccgatgtgagggctcctcggtccagacacgcacctgccacatt
caggagtgcgacaagagatttaaacaggatggtggctggagccactggtccccgtggtca
tcttgttctgtgacttgtggtgacggtgtgatcacaaggatccggctctgcaactctccc
agcccccagatgaacgggaaaccctgtgaaggcgaagcacgggagaccaaagcctgcaag
aaagatgcctgccccatcaatggaggctggggtccttggtcaccatgggacatctgttct
gtcacctgtggaggaggggtacagaaacgtagccggctctgcaacaaccccacaccccag
tttggaggcaaggactgcattggtgacgtgacagaaaaccagatctgcaacaagcaggac
tgtccaattgatggatgcctgtccaatccctgctttgccggtgtgaagtgtactagctac
cctgatggcagctggaaatgtggtgcttgtccgcctggttacagtggaaatggcatccag
tgcacagatgttgatgagtgcaaagaagtgcctgatgcctgcttcaaccacaacggagag
cacaggtgtaagaatacggaccccggctacaactgcctgccctgccccccgcgcttcacc
ggctcacagccctttggccagggcgtcgaatatgccacagccaacaaacaggtgtgcaag
ccccgtaacccctgcacggatggaacccacgactgcaacaagaacgccaagtgcaactac
ctgggccactacagcgaccccatgtaccgctgcgagtgcaagcccggctacgctggcaat
ggcatcatctgcggggaggacacagacctggatggctggcccaatgaggacctggtgtgc
gtggccaatgcgacttaccactgcaaaaaggataattgtcccaacctccccaactcaggc
caggaagactatgacaaggatggaattggtgatgcctgtgatgatgacgatgacaatgat
aaaattccagatgacagggacaactgtccattccattacaacccagctcagtatgactat
gacagagatgacgtgggagaccgctgtgacaactgtccctacaaccacaacccagatcag
gcagacacagacagcaatggggaaggagacgcctgtgctgcagacattgacggggacggt
atcctcaatgaacgggacaactgccagtacgtctacaatgtggaccagagagacactgac
atggatggggttggagatcagtgtgacaactgccccttggaacacaatccagatcagctg
gactctgactcagaccgcattggagatacctgtgacaacaatcaggatattgatgaagat
ggccaccagaacaatctggacaactgtccctatgtgcccaatgccaaccaggctgaccat
gacaaagatggcaagggagatgcctgtgaccacgatgatgacaacgatggcattcctgat
gacagggacaactgcagacttgtgcccaatcccgaccagaaggactctgacggtgatggt
cgaggtgatgcttgcaaagatgattttgaccatgacaatgtgccagacattgatgacatc
tgtcctgagaatgttgacatcagtgagaccgatttccgccgattccagatgattcctctg
gatcccaaagggacatcccaaaatgaccctaactgggttgtacgccatcagggcaaagaa
ctcgtccagacggtcaactgtgaccctggactcgctgtaggttatgacgagtttaatgct
gtggacttcagtggcaccttcttcatcaacaccgaaagggacgatgactatgctggattt
gtctttggctaccagtccagcagccgcttctatgttgtgatgtggaagcaagtcacccag
tcctactgggacaccaaccccacgagggctcaggggtactcaggcctttctgtgaaagtt
gtgaactccaccacggggcctggcgagcacctgcggaatgccctgtggcacacaggaaac
acccctggccaggtgcgcaccctgtggcatgaccctcgtcacataggctggaaagatttc
accgcctacagatggcgtctcagccacaggccaaagacgggtttcattagagtggtgatg
tatgaagggaagaaaatcatggctgactcaggacccatctatgataaaacctatgctggt
ggtagactagggttgtttgtcttctctcaagaaatggtgttcttctccgacctgaaatac
gaatgtagagatccctaa

DBGET integrated database retrieval system