KEGG   Macaca mulatta (rhesus monkey): 705431Help
Entry
705431            CDS       T01028                                 

Gene name
NCOA3
Definition
(RefSeq) nuclear receptor coactivator 3
  KO
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    705431 (NCOA3)
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     705431 (NCOA3)
Chromosome [BR:mcc03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    705431 (NCOA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 1421 aa AA seqDB search
MSGLGENLDPLATDSRKHKLPCDAPGQGLTCSGEKRRREQESKYIEELAELISANLSDID
NFNVKPDKCAILKETVRQIRQIKEQGKTISNDDDVQKADVSSTGQGVIDKDSLGPLLLQA
LDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVNG
VSWTNETQRQKSHTFNCRMLMKTPHDILEDINASPEMRQRYETMQCFALSQPRAMMEEGE
DLQSCMICVARRITTGERAFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRC
IQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDR
HGFVSTHFLQREQNGYRPNPNPVGQGIRPPMAGCNSSVGSMSMSPNQGLQMPSSRAYGLA
DPSTTGQMSGARYGGSSNIASLTPGPGMQSPSSYQNNNYGLSMSSPPHGSPGLAPNQQNI
MISPRNRGSPKIASHQFSPVAGVHSPMGSSGNSGNHSFSSSSLSALQAISEGVGGTSLLS
TLSSPGPKLDNSPNMNITQPSKVSNQDSKSPLGFYCDQNPVESSMCQSNSRDHLSDKESK
ESSVEGSENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKESSVSVTSPSGV
SSSTSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSITSCGDG
NVVKQEQLSPKKKENNALLRYLLDRDDPSDALSKELQPQVEGVDNKISQCTSSTIPSSSQ
EKDPKIKTETSEEGSGDLDNLDAILGDLTSSDFYNNSISSNGSHLGTKQQVFQGTNSVGL
KSPQSVQSIRPPYNRAVSLDSPVSVGSSPPVKNISAFPMLPKQPMLGGNPRMMDSQENYG
SSMGGPNRNVTVTQTPSSGDWGLPNSKASRMEPMNSNSMGRPGGDYNTSLPRPAVGGSMP
TLPLRSNSIPGARPLLQPQQQQQMLQMRPGELPMGMGANPYGQAAASNQLGSWPDGMLSI
EQVPHGTQNRPLLRNSLDDLVGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDRALG
IPELVNQGQALEPKQDAFQGQEAAVMMDQKAGLYGQTYPAQGPPMQGGFHLQGQSPSFNS
MMNQMNQQGNFPLQGMHPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALELKMEN
PTAGGAAVMRPMMQPQQGFLNAQMVAQRSRELLSHHFRQQRVAMMMQQQQQQQQQQQQQQ
QQQQQQQQQQQQQTQAFSPPPNVTASPSMDGLLAGPAMPQAPPQQFPYQPNYGMGQPPDP
AFGRVSSPPSAMISSRMGPSQNPMMQHPQAASIYQSSEMKGWPSGNLARNSSFSQQQFAH
QGNPAVYSMVHMNGSSGHMGQMNMNPMPMSGMPMGPDQKYC
NT seq 4266 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattaggagaaaacttggatccactggccactgattcacgaaaacacaaattg
ccatgtgatgctccaggacaaggtcttacctgcagtggtgaaaagcggagacgggagcag
gaaagtaaatatattgaagaattggctgagctgatatctgccaatcttagtgatattgac
aatttcaatgtcaaaccagataaatgtgcgattttgaaggaaacagtaagacagatacgt
caaataaaagaacaaggaaaaactatttccaatgatgatgatgttcaaaaagccgatgta
tcttctacagggcagggagttattgataaagactccttaggaccgcttttacttcaggca
ttggatggtttcctatttgtggtgaatcgagatggaaacattgtatttgtgtcagaaaat
gtcacacaatacctgcaatataagcaagaggacctggttaacacaagtgtttacaatatc
ttacatgaagaagacagaaaggattttcttaaaaatttaccaaaatctacagttaatgga
gtttcctggacaaatgagacccagagacaaaaaagccatacatttaattgccgtatgttg
atgaaaacaccacatgatattctggaagacataaacgccagtcctgaaatgcgccagaga
tatgaaacaatgcagtgctttgccctgtctcagccacgagctatgatggaggaaggggaa
gatttgcaatcttgtatgatctgtgtggcacgccgcattactacaggtgaaagagcattt
ccatcaaaccctgagagctttattaccagacatgatctttcagggaaggttgtcaatata
gatacaaattcactaagatcctccatgaggcctggctttgaagatataatccgaaggtgt
attcagagattttttagtctaaatgatgggcagtcatggtcccagaaacgtcactatcaa
gaagcttatcttaatggccatgcagaaaccccagtatatcgattctcgttggctgatgga
actatagtgactgcacagacaaaaagcaaactcttccgaaatcctgtaacaaatgatcga
catggctttgtctcaacccactttcttcagagagaacagaatggatatagaccaaaccca
aatcctgttggacaagggattagaccacctatggctggatgcaacagttcagtaggcagc
atgagtatgtcgccaaaccaaggcttacagatgccgagcagcagggcctatggcttggca
gaccctagcaccacagggcagatgagtggagctaggtatgggggttccagtaacatagcc
tcattgacccctgggccaggcatgcaatcaccatcttcctaccagaacaacaactatggg
ctcagcatgagtagccccccacatggaagtcctggtcttgccccaaaccagcagaatatc
atgatttctcctcgtaatcgtgggagtccaaagatagcctcacatcagttttctcctgtt
gcaggtgtgcactctcccatgggatcttctggcaatagtgggaaccacagcttttccagc
agctctctcagtgccctgcaagccatcagtgagggtgtaggggggacttctcttttatct
actctgtcatcaccaggccccaaattggataactctcccaatatgaatataacccaacca
agtaaagtaagcaatcaggattccaagagtccgctgggcttttattgcgaccaaaatcca
gtggagagttcaatgtgtcagtcaaatagcagagatcacctcagtgacaaagaaagtaag
gagagcagtgttgaggggtcagagaatcaaaggggtcctttggaaagcaaaggtcacaaa
aaattactgcagttacttacctgttcttctgatgaccggggtcattcctccttgaccaac
tccccgctagattcaagttgtaaagaatcttctgttagtgtcaccagcccctctggagtc
tcctcctctacatctggaggagtatcctctacatccaatatgcatgggtcactgttacaa
gagaagcaccggattttgcacaagttgctgcagaatgggaattcaccagctgaagtagcg
aagattactgcagaagccactgggaaagacaccagcagtataacttcttgtggggacgga
aatgttgtcaagcaggagcagctaagtcctaagaagaaggagaataatgcacttcttaga
tacctgctggacagggatgatcctagtgatgcactctctaaagaactacagccccaagtg
gaaggagtggataataaaataagtcagtgcaccagctccaccattcctagctcaagtcaa
gagaaagaccctaaaattaagacagagacaagtgaagagggatctggagacttggataat
ctagatgctattcttggtgatctgactagttctgacttttacaataattccatatcctca
aatggtagtcatctggggactaagcaacaggtgtttcaaggaactaattctgtgggtttg
aaaagtccacagtctgtgcagtctattcgtcctccatataaccgagcagtgtctctggat
agtcctgtttctgttggctcaagtcctccagtgaaaaatatcagtgctttccccatgtta
ccaaagcaacccatgttgggtgggaatccaagaatgatggatagtcaggaaaattatggc
tcaagtatgggtggaccaaacagaaatgtgactgtgactcagactccttcctcaggagac
tggggcttaccaaactcaaaggccagcagaatggaacctatgaattcaaactccatggga
agaccaggaggagattataatacttctttacccagacctgcagtgggtggctctatgccc
acgttgcctcttcggtctaatagcataccaggtgcaagaccactattgcagccgcagcaa
cagcaacagatgcttcaaatgaggcctggtgaactccccatgggaatgggggctaatccc
tatggccaagcagcagcatctaaccaactgggttcctggcccgatggcatgttgtcaata
gaacaagttcctcatggcactcaaaataggccccttcttaggaattccctggatgatctt
gtcgggccaccttccaacctggaaggccagagtgatgaaagagcattattggaccagctg
cacactcttctcagcaacacagatgccacaggcctggaagaaattgacagagctttggga
atccctgaacttgtcaatcagggacaggcattagaacccaaacaggatgctttccaaggc
caagaagcagcagtaatgatggatcagaaggcaggattatatggacagacatacccagca
caggggcctccaatgcaaggaggctttcatcttcagggacaatcaccatcttttaactct
atgatgaatcagatgaaccagcaaggcaattttcctctccaaggaatgcacccgcgagcc
aacatcatgagaccccggacaaacacccccaagcaacttagaatgcagcttcagcagagg
ctgcagggccagcagtttttgaatcagagcagacaggcacttgaattgaaaatggaaaac
cctactgctggtggtgctgccgtgatgaggcctatgatgcagccccagcagggttttctt
aatgctcaaatggtcgcccaacgcagcagagagctgctaagtcatcacttccgacaacag
agggtggctatgatgatgcagcagcagcagcagcaacagcagcaacagcaacagcagcag
cagcagcagcagcagcagcagcagcagcagcagcagcaaacccaggccttcagcccacct
cctaatgtgactgcttcccccagcatggatgggcttttggcgggacctgcaatgccacaa
gctccgccgcaacagtttccatatcaaccaaattatggaatgggacaaccaccagatcca
gcctttggtcgagtgtctagtcctcccagtgcaatgatatcgtcaagaatgggtccctcc
cagaatcccatgatgcaacacccccaggctgcatccatctatcagtcctcagaaatgaag
ggctggccatcaggaaatttggccaggaacagctccttttcccagcagcagtttgcccac
caggggaatcccgcagtgtatagtatggtacacatgaatggcagcagtggtcacatggga
cagatgaacatgaaccccatgcccatgtctggcatgcctatgggccctgatcagaaatac
tgctga

DBGET integrated database retrieval system