KEGG   Macaca mulatta (rhesus monkey): 705604Help
Entry
705604            CDS       T01028                                 

Gene name
POMT2
Definition
protein-O-mannosyltransferase 2 (EC:2.4.1.109)
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    705604 (POMT2)
Enzymes [BR:mcc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     705604 (POMT2)
Glycosyltransferases [BR:mcc01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   705604 (POMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 750 aa AA seqDB search
MPPATGGGLAESELRPRRGRCGPQAARAAGRDVATEAAARSPKRPARGSQRFEAAGRWAL
LALVTLLSFATRFHRLAEPRHICWDETHFGKMGSYYINRTFFFDVHPPLGKMLIGLAGYL
SGYDGTFLFQKPGDKYEHHSYMGMRGFCAFLGSWLVPFAYLTVLDLSKSLSAALLTAALL
TFDTGCLTLSQYILLDPILMFFIMAAMLSMVKYNSCANRPFSAPWWFWLSLTGVSLAGAL
GVKFVGLFIILQVGLNTIADLWHLFGDLSLSLVTVGKHLTARVLCLIVLPLALYTATFAV
HFMVLSKSGPGDGFFSSAFQARLSGNNLHNASIPEHLAYGSVITVKNLRMAIGYLHSHRH
LYPEGIGARQQQVTTYLHKDYNNLWIIKKHNTNSDPLDPSFPVEFVRHGDIIRLEHKETS
RNLHSHYHEAPLTRKHYQVTGYGINGTGDSNDFWRIEVVNRKFGNRIKVLRSRIRLIHLV
TGCVLGSSGKVLPKWGWEQLEVTCTPYLKETLNSIWNVEDHINPKLPNISLNVLQPSFPE
ILLESHMVMIRGNSGLKPKDNEFTSKPWHWPINYQGLRFSGINDTDFRVYLLGNPVVWWL
NLLSIALYLLSGSIIAIAIQRGAQLPAEVAGLSQVLLRGGGQVLLGWTLHYFPFFLMGRV
LYFHHYFPAMLFSSMLTGILWDTLLRLCAWGLASWPLARGIHVVGILSLLLGTAYSFYLF
HPLAYGMVGPLAQDPQSPMAGLRWLDSWDF
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgccgccggccacgggcggaggcctggcggagtccgaactgcgtccccggaggggccgc
tgtgggccccaggctgctagggccgcaggccgggacgtggccaccgaggctgcggcgcga
agccccaaacggcctgcccggggctcacagcgcttcgaggcggccggccggtgggccctg
ctggccttggtgacgctgctgtccttcgccacccgtttccaccgcctggccgagccgcgg
cacatctgttgggatgagactcactttggaaaaatgggaagttactatatcaaccgtacg
tttttctttgacgtgcacccacctctgggaaagatgctgataggtcttgctggctacctg
agtggatatgatggtacctttttgttccagaagcctggggataaatatgagcatcacagc
tacatgggaatgagaggattctgtgcattccttggctcctggctggtcccctttgcctac
ctcactgtactggatctgtctaagtccctctcggcagcattgctcaccgctgccctcctc
acctttgacacgggatgcctcactctgtcccagtacatcctccttgaccccatcctgatg
ttcttcatcatggctgccatgctgagcatggtcaagtacaactcctgcgccaacaggccc
ttctctgccccctggtggttctggctcagcctgactggtgttagtcttgctggtgcttta
ggggtcaagtttgttggcctctttatcatccttcaagtggggctgaacaccattgcagac
ctttggcacctgttcggagacctcagtctttcattggtgactgtgggaaaacacctgact
gctcgtgtcctgtgcctcatagtgctgcccctggctctctacacagccacctttgctgtt
cacttcatggtgctgagtaaaagtggccctggtgacggtttcttcagttctgccttccag
gcccggctttcagggaacaacctgcacaatgcttccatccctgaacacctggcctatggc
tctgtgattactgtgaagaacctccgaatggccattggctatctgcactcccacaggcac
ctctaccccgagggcattggtgcccgtcagcagcaggtcaccacctatttgcacaaggac
tacaacaacctgtggattatcaagaaacataacacaaattcagatcccctagacccttcc
ttcccagtggagtttgtaagacatggagacattattcgactagaacacaaagaaacttcc
cggaacttgcacagtcactatcatgaggcccccctgacccggaagcactatcaggtcacc
ggctatggcataaatggaacaggggactcaaatgatttctggcggattgaggttgtaaac
agaaaatttggaaaccggatcaaagtgctgagaagtcgaattcgcctcatccatttggtc
acaggttgtgtcctgggctcctcgggaaaggttctgcccaagtggggctgggagcagttg
gaagttacttgcaccccatacctgaaagaaaccctcaactccatctggaatgtggaggac
catatcaatcccaagttgccaaacatcagcctgaatgtgctgcagcccagttttcctgag
atcttgctagaatcccacatggtcatgatccgggggaacagtggcctcaaacccaaggac
aatgagttcacatccaaaccctggcactggcctatcaactatcagggcctacgcttctca
gggatcaatgacacagacttccgagtctatctgcttggcaacccggtggtttggtggctg
aatctgttgagcatcgccctctacctcctctcagggagcatcattgctatagccatacag
agaggggcacagctgccagcggaggttgcagggttgtcccaggtcctgctgcgaggaggc
ggccaggtcctgctcggctggacactccattacttcccgttcttcctgatgggccgggtc
ctctacttccaccactacttcccagccatgctcttctcaagcatgttgacaggcattctg
tgggacaccctcctgcggctctgtgcctggggcttggcctcttggcccctggcaagaggc
atccacgtggtgggaatcctgagtctgctcctgggaaccgcctacagcttctacctcttc
caccctctggcttacgggatggttggtcccctggcccaggacccccaaagtccgatggca
ggactaaggtggctagactcatgggacttttga

DBGET integrated database retrieval system