KEGG   Macaca mulatta (rhesus monkey): 705753Help
Entry
705753            CDS       T01028                                 

Definition
cytochrome P450 2A13-like
Orthology
K07411  
cytochrome P450, family 2, subfamily A [EC:1.14.14.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Retinol metabolism
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    705753
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     705753
Cytochrome P450 [BR:mcc00199]
 Cytochrome P450, animal type
  CYP2 family
   705753
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 355 aa AA seqDB search
MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLNTEQMYTSIMK
VERYGSVFTIHLGPQQVVVLCGHDAVKEALVDQAEEFSRQGEQATFSWVFKGYVTFSTWE
SAKSPRRFSMATLRDFGVGKTGFLIEALRGTRCSNMDPAFFLSRTVSNVISSIVFGDCFD
YEDKEFLSLLRMMLGSFQFTATSTGQRYEMFSLVMKHLPGPQQQGFKELQGLEDFIAKKV
EHKQHTLDPNSPRDFIDSFLICIQELHPSSQCRELQSQAEGIEAGSSSVCFLPTRGPKAL
SPPPEPRVNLGDLRDIRWSMSSRHQAAAVVREKPGGGEISLPSRQGAGLAAPPRA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgctggcctcagggctgctcctggtggccttgctggcctgcctgactgtgatggtcttg
atgtctgtctggcagcagaggaagagcaggggaaagctgcctccaggacccaccccattg
cccttcattggaaactacctgcagctgaacacagagcagatgtacacctccatcatgaag
gttgagcgctatggctctgtgttcaccattcacctggggccccagcaggtggtggtgctg
tgcggacatgatgccgtcaaggaggctctggtggaccaggctgaggagttcagcaggcaa
ggcgagcaagccactttcagttgggtcttcaaaggctatgtgaccttcagcacctgggag
agcgccaagtcgccccggcgcttctccatggccaccttgcgggacttcggggtgggcaag
acgggcttcctcatcgaggccctccggggcacgcgctgctccaacatggatcccgccttc
ttcctgagccgcactgtctccaatgtcatcagctccattgtctttggggactgctttgac
tatgaggacaaagagttcctgtcactgctgcgcatgatgctgggaagcttccagttcacc
gcaacctccacggggcagcgctatgagatgttctctttggtgatgaaacacctgccagga
ccacagcaacagggctttaaggagctgcaagggttggaggacttcatagccaagaaggtg
gagcacaaacagcacacactggatcccaactccccacgggacttcatcgactcctttctc
atctgcatacaggagctacaccccagcagccagtgcagggagttgcaaagccaggcagag
ggaattgaggctgggagttcttccgtttgctttctccctacccgggggcccaaggcgctg
tctccgccgcccgagccccgcgtaaatctgggtgacctccgagacatccgttggagcatg
agctccagacatcaggcggcggcggtggtccgggagaaacccggcggcggggagataagc
ctgcccagcaggcagggggctgggctagctgccccgccccgcgcctga

DBGET integrated database retrieval system