KEGG   Macaca mulatta (rhesus monkey): 705753Help
Entry
705753            CDS       T01028                                 

Definition
cytochrome P450 2A13-like
Orthology
K07411  
cytochrome P450, family 2, subfamily A [EC:1.14.14.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Retinol metabolism
Class
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:mcc00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 355 aa AA seqDB search
MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLNTEQMYTSIMK
VERYGSVFTIHLGPQQVVVLCGHDAVKEALVDQAEEFSRQGEQATFSWVFKGYVTFSTWE
SAKSPRRFSMATLRDFGVGKTGFLIEALRGTRCSNMDPAFFLSRTVSNVISSIVFGDCFD
YEDKEFLSLLRMMLGSFQFTATSTGQRYEMFSLVMKHLPGPQQQGFKELQGLEDFIAKKV
EHKQHTLDPNSPRDFIDSFLICIQELHPSSQCRELQSQAEGIEAGSSSVCFLPTRGPKAL
SPPPEPRVNLGDLRDIRWSMSSRHQAAAVVREKPGGGEISLPSRQGAGLAAPPRA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgctggcctcagggctgctcctggtggccttgctggcctgcctgactgtgatggtcttg
atgtctgtctggcagcagaggaagagcaggggaaagctgcctccaggacccaccccattg
cccttcattggaaactacctgcagctgaacacagagcagatgtacacctccatcatgaag
gttgagcgctatggctctgtgttcaccattcacctggggccccagcaggtggtggtgctg
tgcggacatgatgccgtcaaggaggctctggtggaccaggctgaggagttcagcaggcaa
ggcgagcaagccactttcagttgggtcttcaaaggctatgtgaccttcagcacctgggag
agcgccaagtcgccccggcgcttctccatggccaccttgcgggacttcggggtgggcaag
acgggcttcctcatcgaggccctccggggcacgcgctgctccaacatggatcccgccttc
ttcctgagccgcactgtctccaatgtcatcagctccattgtctttggggactgctttgac
tatgaggacaaagagttcctgtcactgctgcgcatgatgctgggaagcttccagttcacc
gcaacctccacggggcagcgctatgagatgttctctttggtgatgaaacacctgccagga
ccacagcaacagggctttaaggagctgcaagggttggaggacttcatagccaagaaggtg
gagcacaaacagcacacactggatcccaactccccacgggacttcatcgactcctttctc
atctgcatacaggagctacaccccagcagccagtgcagggagttgcaaagccaggcagag
ggaattgaggctgggagttcttccgtttgctttctccctacccgggggcccaaggcgctg
tctccgccgcccgagccccgcgtaaatctgggtgacctccgagacatccgttggagcatg
agctccagacatcaggcggcggcggtggtccgggagaaacccggcggcggggagataagc
ctgcccagcaggcagggggctgggctagctgccccgccccgcgcctga

DBGET integrated database retrieval system