KEGG   Macaca mulatta (rhesus monkey): 705792Help
Entry
705792            CDS       T01028                                 

Gene name
TYR
Definition
tyrosinase (oculocutaneous albinism IA)
Orthology
K00505  
tyrosinase [EC:1.14.18.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Tyrosine metabolism
Riboflavin metabolism
Metabolic pathways
Melanogenesis
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    705792 (TYR)
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    705792 (TYR)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    705792 (TYR)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.1  tyrosinase
     705792 (TYR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 530 aa AA seqDB search
MILAVLYCLLWSFQTSAGHFPRACVSSKNLMEKECCPPWSGDGSPCGQLSGRGSCQNILL
SNAPLGPQFPFTGVDDRESWPSIFYNRTCQCSGNFTGFDCGNCKFGFWGPNCTDRRLLVR
RNIFDLSAPEKDKFFAYLTLAKHTISSDYVIPIGTYGQMKNGSTPMFSDINIYDLFVWIH
YYVSMDALLGGSEIWRDIDFAHEAPAFLPWHRLFLLRWEQEIQKLTGDENFTIPYWDWRD
AEKCDICTDEYMGGQHPANPNLLSPASFFSSWQIICSRLEEYNSHQSLCNGMPEGPLRRN
PGNHDKSRTPRLPSSADVEFCLSLTQYESGSMDKAANFSFRNTLEGFASPLTGIADASQS
SMHNALHIYMNGTMSQVQGSANDPIFLLHHAFVDSIFEQWLRRHHPLQEVYPEANAPIGH
NRESYMVPFIPLYRNGDFFISSKDLGYDYSYLQDSGSDSFQDYIKSYLEQAGRIWSWLLG
AAMVGAALTALLAGLVSLLCGHKRKQLAEERQPLLMEKEDYHNLLYQSHL
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgatcctggctgttttgtactgcctgctgtggagtttccagacctccgctggccatttc
cctcgagcctgtgtctcctctaagaacctgatggaaaaggaatgctgcccaccatggagt
ggggacgggagtccctgtggccaactttcaggcagaggttcctgtcagaatatccttctg
tccaatgcaccacttgggcctcaatttcccttcacaggggtggatgaccgggagtcgtgg
ccttccatcttttataataggacctgccagtgctctggcaacttcacgggattcgactgt
ggaaactgcaagtttggcttttggggaccaaactgcacagacagacgactcttggtgaga
agaaacatctttgatttgagtgccccagagaaggacaaattttttgcctacctcacttta
gcaaagcataccatcagctcagactatgtcatccccatagggacctacggccaaatgaaa
aatgggtcaacacccatgtttagtgatatcaacatttatgacctctttgtctggatccat
tattatgtgtcaatggatgcactgcttgggggatctgaaatctggagagacattgatttt
gcccatgaagcaccagcttttctgccttggcatagactcttcttgttgcggtgggaacaa
gaaatccagaagctgacaggagatgaaaacttcactattccatattgggactggcgggat
gcagaaaagtgtgacatttgcacagatgagtacatgggaggtcagcaccccgcaaatcct
aacctactcagcccagcatcattcttctcctcttggcagattatctgtagccgattggag
gagtacaacagccatcagtctttatgcaatggaatgcccgagggacctttacggcgcaat
cctggaaaccatgacaaatccagaaccccaaggctcccctcttcagctgacgtagaattt
tgcctgagtttgacccagtatgaatctggttccatggataaagctgccaatttcagcttt
agaaatacactggaaggatttgctagtccacttactgggatagcagatgcctctcaaagc
agcatgcacaatgccttgcacatctatatgaatggaacaatgtcccaggtccagggatct
gccaacgatcccatcttccttcttcaccatgcatttgttgacagtatttttgagcagtgg
ctccgaaggcaccatcctcttcaagaagtttatccagaagccaatgcacccattggacat
aaccgagaatcctacatggttccttttataccactgtacagaaacggtgatttctttatt
tcatccaaagatctgggctatgactatagctacctacaagattcaggctcagactctttt
caagactacattaagtcctatctggaacaagccggtcggatctggtcatggctccttggg
gcggcgatggtaggagccgccctcactgccctgctggcagggcttgtgagcttgctgtgt
ggtcacaagagaaagcagcttgctgaagaaaggcagccactcctcatggagaaagaggat
taccacaacttgttgtatcagagccatttataa

DBGET integrated database retrieval system