KEGG   Macaca mulatta (rhesus monkey): 706004Help
Entry
706004            CDS       T01028                                 

Definition
histone acetyltransferase KAT2A-like
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    706004
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    706004
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    706004
  Infectious diseases
   05166 HTLV-I infection
    706004
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     706004
Transcription machinery [BR:mcc03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     706004
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
16
AA seq 611 aa AA seqDB search
MAEPSQAPTPAPAAQPRPLQSPAPAPTPTPAPSPASAPTPTPTPAPAPAPAAAPAGSTGT
GGPGVGSGGAGSGGDPARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKANETCKC
NGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVE
NLFMSVHKEEDTDTKQVYFYLFKIGEKRKLPENLTLEDAKRLRVMGDIPMELVNEVMLTI
TDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNV
FSHQLPRMPKEYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQ
VKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYE
GATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVE
SVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYY
EVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFY
FKLKEGGLIDK
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaccttcccaggccccgaccccggccccagctgcgcagccccggccccttcag
tccccagcccctgccccaactccgactcctgcacccagcccggcttcagccccgactccg
actcccaccccggcaccagcccctgccccagctgcagccccagccggcagcacagggact
ggggggcccggggtaggaagtgggggggccgggagcgggggggatccggctcgacctggc
ctgagccagcagcagcgcgctagccagaggaaggcgcaagtccgggggctgccgcgcgcc
aagaagcttgagaagctaggggtcttctcggcttgcaaggccaatgaaacctgtaagtgt
aatggctggaaaaaccccaagccccccactgcaccccgcatggatctgcagcagccagct
gccaacctgagtgagctgtgccgcagttgtgagcatcccttggctgaccacgtatctcac
ttggagaatgtgtcagaggatgaaataaaccggctgctggggatggtggtggatgtggag
aatctcttcatgtctgttcacaaggaggaggacacagacaccaagcaggtctatttctac
ctcttcaagataggcgagaagaggaagctcccggagaacctgaccctggaggatgccaag
aggctccgtgtgatgggcgacatccccatggagctagtcaatgaggtcatgctgaccatc
actgaccctgctgccatgctggggcctgagacgagcctgctttcggccaatgcggcccgg
gatgagacagcccgcctggaggagcgccgtggcatcattgagttccacgtcatcggcaac
tcgctgacgcccaaggccaaccggcgggtgttgctctggctcgtggggctgcagaatgtc
ttttcccaccagctgccacgcatgcctaaggagtatatcgcccgcctcgtctttgacccg
aagcacaagactctggccttgatcaaggatgggcgggtcatcggtggcatctgcttccgc
atgtttcccacccagggcttcacggagattgtcttctgtgctgtcacctcgaatgagcag
gtcaagggttatgggacccacctgatgaaccacctgaaggagtatcatatcaagcacaac
attctctacttcctcacctacgcggacgagtacgccatcggctacttcaaaaagcagggt
ttctccaaggacatcaaggtgcccaaaagccgatacctgggctacatcaaggactacgag
ggagcgacactgatggagtgtgagctgaatccccgcatcccctacacagagctgtcccac
atcatcaagaagcagaaagagatcatcaagaagctgattgagcgcaaacaggcccagatc
cgcaaggtctacccggggctcagctgcttcaaggagggcgtgaggcagatccctgtggag
agtgtccctggcattcgagagacgggctggaagccgttggggaaggagaaggggaaggag
ctgaaggaccccgaccagctctacacaaccctcaaaaacctgctggcccaaatcaagtcg
caccccagtgcctggcccttcatggagcctgtgaagaagtcggaggcccctgactactac
gaggtcatccgcttccccattgacctgaagaccatgactgagcggctgcgaagccgctac
tatgtgacccggaagctctttgtggccgacctgcagcgggtcatcgccaactgccgcgag
tacaaccccccggacagcgagtactgccgctgcgccagtgccctggagaagttcttctac
ttcaagctcaaggaaggagggctcattgacaagtag

DBGET integrated database retrieval system