KEGG   Macaca mulatta (rhesus monkey): 706004Help
Entry
706004            CDS       T01028                                 

Gene name
KAT2A
Definition
(RefSeq) K(lysine) acetyltransferase 2A
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    706004 (KAT2A)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    706004 (KAT2A)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    706004 (KAT2A)
  Infectious diseases
   05166 HTLV-I infection
    706004 (KAT2A)
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     706004 (KAT2A)
Transcription machinery [BR:mcc03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     706004 (KAT2A)
Chromosome [BR:mcc03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    706004 (KAT2A)
   HAT complexes
    PCAF complex
     706004 (KAT2A)
    STAGA complex
     706004 (KAT2A)
    TFTC complex
     706004 (KAT2A)
    SAGA complex
     706004 (KAT2A)
    SLIK complex
     706004 (KAT2A)
    ADA-HAT complex
     706004 (KAT2A)
    HAT-A2 complex
     706004 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
16
AA seq 837 aa AA seqDB search
MAEPSQAPTPAPAAQPRPLQSPAPAPTPTPAPSPASAPTPTPTPAPAPAPAAAPAGSTGT
GGPGVGSGGAGSGGDPARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKANETCKC
NGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVE
NLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQ
YKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNYTRWLCYCH
VPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFL
SMLEEEIYGANSPIWESGFTMPPSEGTQLVPRPASVSAAVVPSTPIFSPSMGGGSNSSLS
LDSAGAEPMPGEKRKLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLL
SANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIA
RLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKE
YHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIP
YTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLG
KEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTE
RLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaccttcccaggccccgaccccggccccagctgcgcagccccggccccttcag
tccccagcccctgccccaactccgactcctgcacccagcccggcttcagccccgactccg
actcccaccccggcaccagcccctgccccagctgcagccccagccggcagcacagggact
ggggggcccggggtaggaagtgggggggccgggagcgggggggatccggctcgacctggc
ctgagccagcagcagcgcgctagccagaggaaggcgcaagtccgggggctgccgcgcgcc
aagaagcttgagaagctaggggtcttctcggcttgcaaggccaatgaaacctgtaagtgt
aatggctggaaaaaccccaagccccccactgcaccccgcatggatctgcagcagccagct
gccaacctgagtgagctgtgccgcagttgtgagcatcccttggctgaccacgtatctcac
ttggagaatgtgtcagaggatgaaataaaccggctgctggggatggtggtggatgtggag
aatctcttcatgtctgttcacaaggaggaggacacagacaccaagcaggtctatttctac
ctcttcaagctcctgcggaagtgcatcctgcagatgacccggcccgtggtggaggggtcc
ctgggcagccctccatttgagaaacctaatattgagcagggtgtgctgaactttgtgcag
tacaagtttagtcacctggctccccgggagcggcagacgatgttcgagctctcaaagatg
ttcttgctctgccttaactactggaagcttgagacacctgcccagtttcggcagaggtct
caggctgaagatgtggctacctacaaggtcaattacaccagatggctctgttactgccac
gtgccccagagctgtgatagtctcccccgctacgaaaccactcatgtctttgggcgaagc
cttctccggtccattttcaccgttacccgccggcagctgctggaaaagttccgagtggag
aaggacaaattggtgcccgagaagaggaccctcatcctcactcacttccccaaattcctg
tccatgctggaggaggagatctatggggcaaactctccaatctgggagtcaggcttcacc
atgccaccctcagaggggacacagctggtgccccggccagcttcggtcagtgcagcagtt
gttcccagcacccccatcttcagccccagcatgggcggaggcagcaacagctccctgagt
ctggattctgcaggggccgagcctatgccaggcgagaagaggaagctcccggagaacctg
accctggaggatgccaagaggctccgtgtgatgggcgacatccccatggagctagtcaat
gaggtcatgctgaccatcactgaccctgctgccatgctggggcctgagacgagcctgctt
tcggccaatgcggcccgggatgagacagcccgcctggaggagcgccgtggcatcattgag
ttccacgtcatcggcaactcgctgacgcccaaggccaaccggcgggtgttgctctggctc
gtggggctgcagaatgtcttttcccaccagctgccacgcatgcctaaggagtatatcgcc
cgcctcgtctttgacccgaagcacaagactctggccttgatcaaggatgggcgggtcatc
ggtggcatctgcttccgcatgtttcccacccagggcttcacggagattgtcttctgtgct
gtcacctcgaatgagcaggtcaagggttatgggacccacctgatgaaccacctgaaggag
tatcatatcaagcacaacattctctacttcctcacctacgcggacgagtacgccatcggc
tacttcaaaaagcagggtttctccaaggacatcaaggtgcccaaaagccgatacctgggc
tacatcaaggactacgagggagcgacactgatggagtgtgagctgaatccccgcatcccc
tacacagagctgtcccacatcatcaagaagcagaaagagatcatcaagaagctgattgag
cgcaaacaggcccagatccgcaaggtctacccggggctcagctgcttcaaggagggcgtg
aggcagatccctgtggagagtgtccctggcattcgagagacgggctggaagccgttgggg
aaggagaaggggaaggagctgaaggaccccgaccagctctacacaaccctcaaaaacctg
ctggcccaaatcaagtcgcaccccagtgcctggcccttcatggagcctgtgaagaagtcg
gaggcccctgactactacgaggtcatccgcttccccattgacctgaagaccatgactgag
cggctgcgaagccgctactatgtgacccggaagctctttgtggccgacctgcagcgggtc
atcgccaactgccgcgagtacaaccccccggacagcgagtactgccgctgcgccagtgcc
ctggagaagttcttctacttcaagctcaaggaaggagggctcattgacaagtag

DBGET integrated database retrieval system