KEGG   Macaca mulatta (rhesus monkey): 706211Help
Entry
706211            CDS       T01028                                 

Gene name
PGAM1
Definition
(RefSeq) phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00010  Glycolysis / Gluconeogenesis
mcc00260  Glycine, serine and threonine metabolism
mcc01100  Metabolic pathways
mcc01200  Carbon metabolism
mcc01230  Biosynthesis of amino acids
mcc04922  Glucagon signaling pathway
mcc05230  Central carbon metabolism in cancer
Module
mcc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mcc_M00002  Glycolysis, core module involving three-carbon compounds
mcc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    706211 (PGAM1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    706211 (PGAM1)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    706211 (PGAM1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    706211 (PGAM1)
Enzymes [BR:mcc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     706211 (PGAM1)
Membrane trafficking [BR:mcc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    706211 (PGAM1)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   706211 (PGAM1)
  Exosomal proteins of melanoma cells
   706211 (PGAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 706211
NCBI-ProteinID: NP_001182584
Ensembl: ENSMMUG00000020027
UniProt: F7GGM3
Position
9
AA seq 254 aa AA seqDB search
MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQ
KRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYD
VPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKR
VLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVR
KAMEAVAAQGKAKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctacaagctggtgctgatccggcacggcgagagcgcatggaacctggagaac
cgcttcagcggctggtacgacgccgacctgagcccagcgggccacgaggaggcgaagcgc
ggcgggcaggcgctgcgagatgctggctatgagtttgacatctgcttcacctcagtacag
aagagagcgatccggaccctctggacagtgctagatgccattgatcagatgtggctgcca
gtggtgaggacttggcgcctcaatgagcggcactatgggggtctaaccggtctcaataaa
gcagaaactgctgcaaagcatggtgaggcccaggtgaagatctggaggcgctcctatgat
gtcccaccacctccgatggagcccgaccaccctttctacagcaacatcagtaaggatcgc
aggtatgcagacctcacagaagatcagctaccctcctgtgagagtctgaaggacactatt
gccagagctctgcccttctggaatgaagaaatagttccccagatcaaggaggggaaacgt
gtactgattgcagcccatggcaacagcctccggggcattgtcaagcatctggagggtctc
tctgaagaggctatcatggagctgaacctgccgactggtattcccattgtctatgaattg
gacaagaacttgaagcctatcaagcccatgcagttcctgggggatgaagagacggtgcgc
aaagccatggaagctgtggccgcccagggcaaggccaagaagtga

DBGET integrated database retrieval system