KEGG   Macaca mulatta (rhesus monkey): 706254Help
Entry
706254            CDS       T01028                                 

Gene name
PTPN7
Definition
protein tyrosine phosphatase, non-receptor type 7
Orthology
K18019  
tyrosine-protein phosphatase non-receptor type 7 [EC:3.1.3.48]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    706254 (PTPN7)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     706254 (PTPN7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 465 aa AA seqDB search
MVGKAWPLTHSQGTGPWAPEGHRREAADPWWQRQQAQEGRMQLGCAWVAARRGGGRKLAS
WSLLSPQRQTDRQTDSWQEAAWGPQLLQQTSWLNEPPLGLAPHPSMVQACWGRSRAQPLT
LSLGAAMTQPPPAKTPAKKHVRLQERRGSNVALMLDVRSLGAVEPICSVNTPREVTLHFL
RTAGHPLTRWALQHQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPNPQSR
VCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLT
QLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQYREECRSVKHILFSAW
PDHQTPESAGPLLRLVAEVEESPETAARPGPIVVHCSAGIGRTGCFIATRIGCQQLKARG
EVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggtcgggaaggcctggcccctcacccattcccagggaacagggccttgggccccagaa
gggcacaggcgggaggcagccgacccctggtggcagcggcagcaggcacaggagggcaga
atgcagctggggtgtgcgtgggtggcagcaaggaggggcggagggaggaagctggcttcc
tggagccttctcagccctcaaagacagaccgacagacagacagacagctggcaagaggca
gcctgggggccacagctgcttcagcagacctcatggctgaatgagcctcccctgggccta
gcaccccaccccagcatggtccaggcctgttgggggcgctccagagcacagccgctgacc
ttgtctttgggggcagccatgacccagcctccgcctgccaaaacgccagccaagaagcat
gtacggctccaggagaggcggggctccaatgtggctctgatgttggacgttcggtcgctg
ggggccgtagaacccatctgctccgtgaacacaccccgggaggtcaccctacatttcctg
cgcactgctggacaccctcttacccgctgggcccttcagcaccagccacccagccccaag
cagctggaagaagaattcttgaagatcccttcaaactttgtcagccccgaagacctggac
atccctggccacgcctccaaggaccgatacaagaccatcttgccaaatccccagagccgt
gtctgtctaggccgggcacagagccaggaggacggagattacatcaatgccaactacatc
cgaggctatgatgggaaggagaaggtctacattgccacccagggccccatgcccaacact
gtgtcggacttctgggagatggtgtggcaagaggaagtgtccctcattgtcatgctcact
cagctccgagagggcaaggagaaatgtgtccactactggcccacagaagaggaaacctat
ggacccttccagattcgcatccaggacatgaaagagtgcccagaatacactgtgcggcag
ctcaccatccagtaccgggaagagtgccggtcagtaaagcacatcctcttctcagcctgg
cccgaccaccagacaccagaatcagctgggcccctgctgcgcctagtggcagaggtggag
gagagcccggagacagctgcccgccccgggcccattgtagtccactgcagtgcagggatt
ggccggacaggctgcttcatcgccacgcgaattggctgtcaacagctgaaggcccgaggg
gaagtggacattctgggcattgtgtgccaactgcggctagacagaggggggatgatccag
acggcagagcagtaccagttcctgcaccacactttggccctgtatgcaggccagcttcca
gaggaacccagcccctga

DBGET integrated database retrieval system