KEGG   Macaca mulatta (rhesus monkey): 706466Help
Entry
706466            CDS       T01028                                 

Gene name
RNASE2, RAF3
Definition
(RefSeq) ribonuclease A family member 2
  KO
K01168  pancreatic ribonuclease [EC:3.1.27.5]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     706466 (RNASE2)
Messenger RNA biogenesis [BR:mcc03019]
 Eukaryotic Type
  mRNA degradation factors
   Other degradation factors
    RNases
     706466 (RNASE2)
Membrane trafficking [BR:mcc04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    706466 (RNASE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RnaseA DUF4957 Peptidase_Mx1
Motif
Other DBs
NCBI-GeneID: 706466
NCBI-ProteinID: XP_001094839
Ensembl: ENSMMUG00000046252
UniProt: F7CXW8
Position
7
AA seq 160 aa AA seqDB search
MVPKLFTSPICLLLLLGLMGVEGSLHAKPGQFTWAQWFEIQHINMTSGQCTNAMLVINNY
QRRCKNQNTFLLTTFADVVHVCGNPSMPCPSNTSLNNCHHSGVQVPLIHCNLTTPSRRIS
NCRYTQTTANKYYIVACNNSDPVRDPPQYPVVPVHLDRVI
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggttccaaaactgttcacttccccaatttgtctgcttcttctgttggggcttatgggt
gtggaaggctcacttcatgccaaacccggacaatttacctgggctcagtggtttgaaatc
cagcatataaatatgacctctggccaatgcaccaatgcaatgctggtaattaacaattat
caacggcgatgcaaaaatcaaaatacttttcttcttacaacttttgctgatgtagttcat
gtctgtggtaacccaagcatgccctgccctagcaacacaagtctcaacaattgtcatcat
agtggagtccaggtgcctttaatccactgtaacctcacaactccaagtcgaaggatttca
aattgcaggtatacacagacaacagcaaacaagtactacatagttgcatgtaacaacagc
gatccagtacgggaccctccacagtatccagtggttccagttcacttggatagagtcatc
taa

DBGET integrated database retrieval system