KEGG   Macaca mulatta (rhesus monkey): 706466Help
Entry
706466            CDS       T01028                                 

Gene name
RNASE2, RAF3
Definition
ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin)
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     706466 (RNASE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 160 aa AA seqDB search
MVPKLFTSPICLLLLLGLMGVEGSLHAKPGQFTWAQWFEIQHINMTSGQCTNAMLVINNY
QRRCKNQNTFLLTTFADVVHVCGNPSMPCPSNTSLNNCHHSGVQVPLIHCNLTTPSRRIS
NCRYTQTTANKYYIVACNNSDPVRDPPQYPVVPVHLDRVI
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggttccaaaactgttcacttccccaatttgtctgcttcttctgttggggcttatgggt
gtggaaggctcacttcatgccaaacccggacaatttacctgggctcagtggtttgaaatc
cagcatataaatatgacctctggccaatgcaccaatgcaatgctggtaattaacaattat
caacggcgatgcaaaaatcaaaatacttttcttcttacaacttttgctgatgtagttcat
gtctgtggtaacccaagcatgccctgccctagcaacacaagtctcaacaattgtcatcat
agtggagtccaggtgcctttaatccactgtaacctcacaactccaagtcgaaggatttca
aattgcaggtatacacagacaacagcaaacaagtactacatagttgcatgtaacaacagc
gatccagtacgggaccctccacagtatccagtggttccagttcacttggatagagtcatc
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system