KEGG   Macaca mulatta (rhesus monkey): 706555Help
Entry
706555            CDS       T01028                                 

Gene name
USP11
Definition
ubiquitin specific peptidase 11
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     706555 (USP11)
Peptidases [BR:mcc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   706555 (USP11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
X
AA seq 963 aa AA seqDB search
MAVAPRLFGGLCFRFRDQNPEVAVEGRLPISHSCVGCRGERTAMATVAANPAAAAAAVAA
AVAVAEDREPQREELPGLDSQWRQIENGESGRERPLRAGESWFLVEKHWYKQWEAYVQGG
DQDSSTFPGCINNATLFQDEINWRLKEGLVEGEDYVLLPAAAWHYLVSWYGLEHGQPPIE
RKVIELPNIQKVEVYPVELLLVRHNDLGRSHTVQFSHTDSIGMVLRTARERFLVEPQEDT
RLWAKNSEGSLDRLYDTHITVLDAALETGQLIIMETRKKDGTWPSAQLHVMNKHMSEEDE
DFKGQPGICGLTNLGNTCFMNSALQCLSNVPQLTEYFLNNCYLEELNFRNPLGMKGEIAE
AYADLVKQAWSGHHRSIVPHVFKNKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVK
KKEYVELCDAAGRPDQEVAQEAWQNHKRRNDSVIVDTFHGLFKSTLVCPDCGNVSVTFDP
FCYLSVPLPISHKRVLEVFFIPMDPRRKPEQHRLVVPKKGKISDLCVALSKHTGISPERM
MVADVFSHRFYKLYQLEEPLSSILDRDDIFVYEVSGRIEAIEGSREDIVVPVYLRERTPA
RDYNNSYYGLMLFGHPLLVSVPRDRFTWEGLYNVLMYRLSRYVSKPNSDDEDDGDEKEDD
EEDKDDVPGPSTGGSLRDPEPEQAGPSSGVTNRCPFLLDNCLGTSQWPPRRRRKQLFTLQ
TVNSNGTSDRTTSPEEVHAQPYIAIDWEPEMKKRYYDEIEAEGYVKHDCVGYVMKKAPVR
LQECIELFTTVETLEKENPWYCPSCKQHQLATKKLDLWMLPEILIIHLKRFSYTKFSREK
LDTLVEFPIRDLDFSEFVIQPQNESNPELYKYDLIAVSNHYGGMRDGHYTTFACNKDSGQ
WHYFDDNSVSPVNENQIESKAAYVLFYQRQDVARRLLSPAGSSGAPASPACNSPPSSEFM
DVN
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagccccgcgactgtttggggggctctgcttccgtttccgggaccagaatccg
gaagtggctgttgaggggcgtcttccaatctcgcacagctgcgttggctgtagaggagaa
cggacagcgatggcgacggtcgcagcaaatccagctgctgctgcggcggctgtggcggcg
gcggtggcggtggctgaggatagagagccacagcgcgaggagctgccaggcctagacagc
cagtggcgccagatagaaaacggcgagagtgggcgagaacgtccactgcgggccggcgaa
agctggttccttgtggagaagcactggtataagcagtgggaggcatacgtgcagggaggg
gaccaggactccagcacctttcctggctgcatcaacaatgccacactctttcaagatgag
ataaactggcgcctcaaggagggactggtggagggcgaggattatgtgctgctcccagca
gctgcttggcattacctggtcagctggtatggtctagagcatggccagccacccattgaa
cgcaaggtcatagagctgcccaacatccagaaggtcgaagtgtacccagtagaactgctg
cttgtccggcacaatgatttgggcagatctcacactgttcagttcagccatactgattct
attggcatggtattgcgcacagctcgggagcggtttctggtggagccccaggaagacaca
cggctttgggccaagaactcagaaggctctttggataggttgtatgacacacacatcacg
gttcttgatgcggcccttgagactgggcagttgatcatcatggagacccgcaagaaagat
ggcacttggcccagcgcacagctgcatgtcatgaacaagcacatgtcggaagaggatgag
gacttcaagggccagccaggcatctgtggcctcaccaatctgggcaacacgtgcttcatg
aactcggccctgcagtgcctcagcaacgtgccacagctcaccgagtatttcctcaacaac
tgctacctggaggagctcaacttccgcaacccactgggcatgaagggtgagattgcagag
gcctatgcagacctggtgaagcaggcatggtctggccaccaccgctccatcgtgccacat
gtgttcaagaacaaggtcggccattttgcatcccaatttctgggctaccagcagcatgac
tctcaggagttgctgtcattcctcctggacgggctgcatgaggaccttaatcgggtgaag
aagaaggagtatgtggagctgtgtgatgctgctgggcgaccggatcaggaggtggcacag
gaggcgtggcaaaaccacaaacggcggaacgattctgtgatcgtggacactttccatggc
ctcttcaagtccacgctggtgtgccccgattgtggcaacgtatctgtgaccttcgacccc
ttctgctacctcagtgttccactgcctatcagccacaagagggtcttggaggtcttcttt
atccccatggatccgcgccgcaagccagagcagcaccggctcgtggtccccaagaaaggc
aagatctcggatctgtgtgtggctctgtccaaacacactggcatctcgccagagaggatg
atggtggctgatgtcttcagtcaccgcttctataagctctatcagctggaggagcctctg
agcagcatcttggaccgcgatgatatcttcgtctatgaggtgtcaggtcgcattgaggcc
atcgagggatcgagagaggacatcgtggttcctgtctacctgcgggagcgcacccctgcc
cgtgactacaacaattcctactatggcctgatgctttttgggcaccccctcctggtatca
gtgccccgggaccgcttcacctgggagggcctgtataacgtcctgatgtaccggctctca
cgctacgtgtctaaacccaactcagatgatgaggacgatggggatgagaaagaagatgac
gaagaggataaagacgacgtccctgggccctcaactgggggcagcctccgagaccctgag
ccagagcaggctgggcccagctctggagtcacgaacaggtgcccattcctcctggacaat
tgccttggcacatctcagtggcccccaaggcgacggcgcaagcagctgttcaccctgcag
acggtgaactccaatgggaccagtgaccgcacaacctcccctgaagaagtccatgcccag
ccatacattgctattgactgggagccagagatgaagaagcgttactatgacgagatagag
gctgagggctacgtgaagcatgactgcgttgggtacgtgatgaagaaggctcccgtgcgg
ctgcaggagtgcattgagctcttcaccactgtggagaccctggagaaggaaaacccctgg
tactgcccctcctgcaagcagcatcagctggccaccaagaagctggacctgtggatgctg
ccagagattctcatcatccacctgaaacgcttttcctacaccaagttctcccgagagaag
ctggacaccctcgtggagtttcctatccgggacctggacttctctgagtttgtcatccag
ccacagaatgagtcgaatccggagctgtacaaatatgacctcatcgcggtttccaaccat
tatgggggcatgcgtgatggacactacacaacatttgcctgcaataaggacagcggccag
tggcactactttgatgacaacagcgtctcccctgtgaatgagaatcagattgagtccaag
gcagcctatgtcctcttctaccaacgccaggatgtggcgcgacgcctgctgtccccggcc
ggctcatctggcgccccagcctcccctgcctgcaactccccacccagctctgagttcatg
gatgttaattga

DBGET integrated database retrieval system