KEGG   Macaca mulatta (rhesus monkey): 706607Help
Entry
706607            CDS       T01028                                 

Gene name
USP30
Definition
ubiquitin specific peptidase 30 (EC:3.4.19.12)
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.4.19.12]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     706607 (USP30)
Peptidases [BR:mcc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   706607 (USP30)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
11
AA seq 517 aa AA seqDB search
MLSSRAEAAMTAADRAIQRFLRTGAAVRYKVMKNWGVIGGIAAALAAGIYVIWGPITERK
KRRKGLVPGLVNLGNTCFMNSLLQGLSACPAFIRWLEEFTSQYTRDQKEPPSHQYLSLTL
LHLLKALSCQEVTDDEVLDASCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQ
PRVTHLFDVHSLEQQSEITPKQITCRTRGSPHPTSNHWKSQHPFHGRLTSNMVCKHCEHQ
SPVRFDTFDSLSLSIPAATWGHPLTLDHCLHHFISSESVRDVVCDNCTKIEAKGTLNGEK
VEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLG
HKPSQHNPKLNKNPGPTLELQDGPGAPTPVLNQPGAPKTQIFMNGACSPSLLPTLSAPMP
FPLPVVPDYSSSTYLFRLMAVVVHHGDMHSGHFVTYRRSPPSARNPLSTSNQWLWVSDDT
VRKASLQEVLSSSAYLLFYERVLSRMQHQSQEYKSEE
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctgagctcacgggccgaggcggcgatgaccgcggccgacagggccatccagcgcttc
ctgaggaccggggcggccgtcagatataaagtcatgaagaactggggagttataggtgga
attgctgctgctcttgcagcaggaatatatgttatttggggtcccattacagaaagaaag
aagcgtagaaaagggctcgtgcctggccttgttaatttagggaacacctgcttcatgaac
tccctgcttcaaggcctgtctgcctgtcctgctttcatcaggtggctggaagagttcacc
tcccagtacaccagggatcagaaggagcccccctcacaccagtatttatccttaacactg
ttgcaccttctgaaagccttgtcctgccaagaagttactgatgatgaggtcttagatgca
agctgcttattggatgtcttaagaatgtacagatggcagatctcatcatttgaagaacag
gatgctcacgaattattccatgtcattacctcgtcattggaagatgagcgagaccgccag
cctcgggtcacacatttgtttgatgtgcattccctggagcagcagtcagaaataactccc
aaacaaattacctgccgcacaagagggtcacctcaccccacatccaatcactggaagtct
caacatccttttcatggaagactcactagtaatatggtctgcaaacactgtgaacaccag
agtcctgttcgatttgatacctttgatagcctttcactaagtattccagccgccacatgg
ggtcacccattgaccctggaccactgccttcaccacttcatctcatcagaatcagtgcgg
gatgttgtgtgtgacaactgtacaaagattgaagccaagggaacgttgaatggggaaaag
gtggaacatcagaggaccacttttgttaaacagttaaaactagggaagctccctcagtgt
ctgtgcatccacctacaacggctgagctggtccagtcacggcacgcctctgaagcggcac
gagcacgtgcagttcaatgagttcctgatgatggacatttacaagtaccacctccttgga
cataaacctagtcaacacaaccctaaactgaacaagaacccagggcctacactggagctg
caggatgggccgggagcccccacgccagttctgaatcagccaggggcccccaaaacacag
atttttatgaatggcgcctgctccccatctttattaccaacactgtccgcaccgatgccc
ttccctctcccggttgttcccgactacagctcctccacatacctcttccggctgatggca
gttgtcgtccaccatggagacatgcactctggacactttgtcacttaccgacggtcccca
ccttcggccaggaaccctctctcaaccagcaaccagtggctgtgggtctccgatgacact
gtccgcaaggccagcctgcaggaggtcctgtcctccagcgcctacctgctgttctatgag
cgcgtcctttccaggatgcaacaccagagccaggagtacaagtctgaagaatga

DBGET integrated database retrieval system