KEGG   Macaca mulatta (rhesus monkey): 706634Help
Entry
706634            CDS       T01028                                 

Definition
(RefSeq) glutathione S-transferase theta-2B
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00480  Glutathione metabolism
mcc00980  Metabolism of xenobiotics by cytochrome P450
mcc00982  Drug metabolism - cytochrome P450
mcc00983  Drug metabolism - other enzymes
mcc01524  Platinum drug resistance
mcc05200  Pathways in cancer
mcc05204  Chemical carcinogenesis
mcc05225  Hepatocellular carcinoma
mcc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    706634
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    706634
   00982 Drug metabolism - cytochrome P450
    706634
   00983 Drug metabolism - other enzymes
    706634
 Human Diseases
  Cancers
   05200 Pathways in cancer
    706634
   05204 Chemical carcinogenesis
    706634
   05225 Hepatocellular carcinoma
    706634
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    706634
  Drug resistance
   01524 Platinum drug resistance
    706634
Enzymes [BR:mcc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     706634
Transporters [BR:mcc02000]
 Other Transporters
  Pores ion channels [TC:1]
   706634
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_C GST_N_2 GST_C_2 GST_C_3 Oxidored_nitro
Motif
Other DBs
NCBI-GeneID: 706634
NCBI-ProteinID: XP_001106693
Ensembl: ENSMMUG00000018530
UniProt: F7A219
Position
2
AA seq 244 aa AA seqDB search
MGLELYLNLLSQPSRAVYIFAKKNGIPFELRTVDIIKGQHRSKEFFQINSLQKVPVLKDG
DFILTESSAILIYLSCKYQTADHWYPSDLQARARVHEYLGWHADCIRGTFGVPMWVQVLG
PLIGVQVPEEKVERNRTAIDQALQWLENKFLGDRLFLAGQQVTLADLMALEELMQPVAVG
YELFKGRPRLAAWRERVEAFLDAELCQEAHSLILSTLEQAAKKTLPTPPPEVYPTMLLRI
ARIP
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgggcctagaactgtacctgaacctgttgtcccagcccagccgcgccgtctacatcttc
gccaagaagaatggcatccccttcgaactgcgcactgtggatattatcaaagggcagcac
agaagcaaggagttcttccagatcaacagcctgcagaaagtgcctgtgctcaaggatggt
gatttcatcttgaccgaaagctcagccatcctgatttacctgagctgtaagtaccagacg
gcggaccactggtatccatctgacctgcaggctcgtgcccgtgttcatgagtacctgggt
tggcatgctgactgcatccgcggcacctttggtgtacccatgtgggtccaggtgttgggg
ccactcattggggtccaggtgcccgaagagaaggtggaacgcaacaggactgccatagac
caggccctgcaatggctggagaacaagttcctgggggacaggctcttccttgctggccag
caggtgacgctggctgatctcatggcgctggaggagctgatgcagccggtggctgtcggc
tacgaactattcaagggacggccacgactggcagcatggcgtgaacgagtggaggctttc
ctggatgctgagctgtgccaggaggcccacagcctcatcttgagcaccctggaacaggcg
gccaagaaaaccctcccaacacccccaccagaggtctatccgactatgctacttcgaatt
gccaggatcccctga

DBGET integrated database retrieval system