KEGG   Macaca mulatta (rhesus monkey): 706634Help
Entry
706634            CDS       T01028                                 

Definition
(RefSeq) glutathione S-transferase theta-2B
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Hepatocellular carcinoma
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    706634
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    706634
   00982 Drug metabolism - cytochrome P450
    706634
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    706634
   05225 Hepatocellular carcinoma
    706634
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    706634
  Drug resistance
   01524 Platinum drug resistance
    706634
Enzymes [BR:mcc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     706634
Transporters [BR:mcc02000]
 Other Transporters
  Pores ion channels [TC:1]
   706634
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
2
AA seq 244 aa AA seqDB search
MGLELYLNLLSQPSRAVYIFAKKNGIPFELRTVDIIKGQHRSKEFFQINSLQKVPVLKDG
DFILTESSAILIYLSCKYQTADHWYPSDLQARARVHEYLGWHADCIRGTFGVPMWVQVLG
PLIGVQVPEEKVERNRTAIDQALQWLENKFLGDRLFLAGQQVTLADLMALEELMQPVAVG
YELFKGRPRLAAWRERVEAFLDAELCQEAHSLILSTLEQAAKKTLPTPPPEVYPTMLLRI
ARIP
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgggcctagaactgtacctgaacctgttgtcccagcccagccgcgccgtctacatcttc
gccaagaagaatggcatccccttcgaactgcgcactgtggatattatcaaagggcagcac
agaagcaaggagttcttccagatcaacagcctgcagaaagtgcctgtgctcaaggatggt
gatttcatcttgaccgaaagctcagccatcctgatttacctgagctgtaagtaccagacg
gcggaccactggtatccatctgacctgcaggctcgtgcccgtgttcatgagtacctgggt
tggcatgctgactgcatccgcggcacctttggtgtacccatgtgggtccaggtgttgggg
ccactcattggggtccaggtgcccgaagagaaggtggaacgcaacaggactgccatagac
caggccctgcaatggctggagaacaagttcctgggggacaggctcttccttgctggccag
caggtgacgctggctgatctcatggcgctggaggagctgatgcagccggtggctgtcggc
tacgaactattcaagggacggccacgactggcagcatggcgtgaacgagtggaggctttc
ctggatgctgagctgtgccaggaggcccacagcctcatcttgagcaccctggaacaggcg
gccaagaaaaccctcccaacacccccaccagaggtctatccgactatgctacttcgaatt
gccaggatcccctga

DBGET integrated database retrieval system