KEGG   Macaca mulatta (rhesus monkey): 706909Help
Entry
706909            CDS       T01028                                 

Gene name
ACACB
Definition
(RefSeq) acetyl-CoA carboxylase beta
  KO
K01946  
acetyl-CoA carboxylase / biotin carboxylase 2 [EC:6.4.1.2 6.3.4.14]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
AMPK signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Glucagon signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    706909 (ACACB)
   00640 Propanoate metabolism
    706909 (ACACB)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    706909 (ACACB)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    706909 (ACACB)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    706909 (ACACB)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    706909 (ACACB)
   04922 Glucagon signaling pathway
    706909 (ACACB)
   04920 Adipocytokine signaling pathway
    706909 (ACACB)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    706909 (ACACB)
Enzymes [BR:mcc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     706909 (ACACB)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     706909 (ACACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 2458 aa AA seqDB search
MVFLLCLSCLIFSCLTFSWLKIWGKMTDSQPITKSTSEANFILSQEPFPASDNSGETPQR
NGEDHSLPKTPSQAEPASHKGPKDAGRRRNSLPPSHQKPPKNPLSSSDAAPSPELQANGT
GTQGLEAPDTNGLSSSARPQGQQAGSPSKEDRKQANIKRQLMTNFILGSFDDYSSDEDSV
AGSSRESTRKGSRASLGALSLEAALTAGEAETRVPTMRPSMSGLHLVKRGREHKKLDLHR
DFTVASPAEFVTRFGGDRVIEKVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVT
PEDLKANAEYIKMADQYVPVPGGPNNNNYANVELIVDIAKRIPVQAVWAGWGHASENPKL
PELLCKNGVAFLGPPSEAMWALGDKIASTIVAQTLQVPTLPWSGSGLTVEWTEDDLQQGK
IISVPEDVYDQGCVKDVDEGLEAAEKIGFPLMIKASEGGGGKGIRKAESAEDFPILFRQV
QSEIPGSPIFLMKLAQHARHLEVQILADQYGNAVSLFGRDCSIQRRHQKIVEEAPATIAP
LAIFEFMEQCAVRLAKTVGYVSAGTVEYLYSQDGSFHFLELNPRLQVEHPCTEMIADVNL
PAAQLQIAMGVPLHRLKDIRLLYGESPWGVTPISFETPSNPPLARGHVIAARITSENPDE
GFKPSSGTVQELNFRSSKNVWGYFSVAATGGLHEFADSQFGHCFSWGENREEAISNMVVA
LKELSIRGDFRTTVEYLINLLETESFQNNDIDTGWLDYLIAEKVQAEKPDIMLGVVCGAL
NVADAMFRTCMTDFLHCLERGQVLPADSLLNIVDVELIYGGIKYILKVARQSLTMFVLIM
NGCHIEIDAHRLNDGGLLLSYNGNSYTTYMKEEVDSYRITIGNKTCVFEKENDPTVLRSP
SAGKLTQYTVEDGGHVEAGSSYAEMEVMKMIMTLNVQESGRVKYIKRPGAVLEAGCVVAR
LELDDPSKVHPAEPFTGELPAQQTLPILGEKLHQVFHSVLENLTNVMSGFCLPEPIFSIK
LKEWVQKLMMTLRHPSLPLLELQEIMTSVAGRIPAPVEKSVRRVMAQYASNITSVLCQFP
SQQIATILDCHAATLQRKADREVFFLNTQSIVQLVQRYRSGIRGYMKTVVLDLLRRYLHV
EHHFQQAHYDKCVINLREQFKPDMSQVLDCIFSHAQVAKKNQLVIMLIDELCGPDPSLSD
ELTSILNELTQLSKSEHCKVALRARQILIASHLPSYELRHNQVESIFLSAIDMYGHQFCP
ENLKKLIISETTIFDVLPAFFYHANKVVCMASLEVYVRRGYIAYELNSLQHRQLPDGTCV
VEFQFMLPSSHPNRMTVPISITNPDLLRHSTELFMDSGFSPLCQRMGAMVAFRRFEDFTR
NFDEVISCFANVPKDTPLFSEARTSLYSEDDCKSLREDPIHILNVSIQCADHLEDEALVP
ILRTFVQSKKNILVDYGLRRITFLIAQEKEFPKFFTFRARDEFAEDRIYRHLEPALAFQL
ELSRMRNFDLTAVPCANHKMHLYLGAAKVKEGAEVTDHRFFIRAIIRHSDLITKEASFEY
LQNEGERLLLEAMDELEVAFNNTSVRTDCNHIFLNFVPTVIMDPLKIEESVRSMVMRYGS
RLWKLRVLQAEVKINIRQTTTGSAVPIRLFITNESGYYLDISLYKEVTDSRSGNIMFHSF
GNKQGPQHGMLINTPYVTKDLLQAKRFQAQSLGTTYIYDFPEIFRQALFKLWGSPDKYPK
DILTYTELVLDSQGQLVEMNRLPGGNEVGMVAFKMRFKTQEYPEGRDMIVIGNDITFRIG
SFGPGEDLLYLRASEMARAEGIPKIYVAANSGARIGMAEEIKHMFHVAWVDPEDPHKGFK
YLYLTPQDYTRISSLNSVHCKHIEEGGESRYMITDIIGKDDGLGVENLRGSGMIAGESSL
AYEEIVTISLVTCRALGIGAYLVRLGQRVIQVENSHIILTGASALNKVLGREVYTSNNQL
GGVQIMHYNGVSHITVPDDFEGVYTILEWLSYMPKDNHSPVPIITPTDPIDREIEFLPSR
APYDPRWMLAGRPHPTLKGTWQSGFFDHGSFKEIMAPWAQTVVTGRARLGGIPVGVIAVE
TRTVEVVVPADPANLDSEAKIIQQAGQVWFPDSAYKTAQAIKDFNREKLPLMIFANWRGF
SGGMKDMYDQVLKFGAYIVDGLRQYKQPILIYIPPYAELRGGSWVVIDATINPLCIEMYA
DKESRGGVLEPEGTVEIKFRKKDLIKSMRRIDPAYKKLMEQLGEPDLSDKDRRDLEGRLK
AREDLLLPIYHQVAVQFADFHDTPGRMLEKGVISDILEWKTARTFLYWRLRRLLLEDQVK
QEILRASGELSHVHIQSMLRRWFVETEGAVKAYLWDNNQVVVQWLEQHWQVEDGPRSTIR
ENITYLKHDSVLKTIRGLVQENPEVAVDCVIYLSQHISPAERAQVIHLLSTMDSPAST
NT seq 7377 nt NT seq  +upstreamnt  +downstreamnt
atggtctttcttctttgtctatcttgtctgattttctcctgtctgaccttttcctggtta
aaaatctgggggaaaatgacggactcccagccaatcaccaagagtacatcagaagcaaac
ttcatcctgagccaggagccctttccagcctctgacaactcaggggagacaccgcagaga
aatggggaggaccactctctgcccaagactcccagccaggccgagccagcctcccacaaa
ggccccaaagatgctggtcggcggagaaactccctgccaccctcccaccagaagccccca
aaaaaccccctttcttccagtgacgcagcaccctccccagagctccaagccaacgggacc
gggacacaaggtctggaggccccagataccaatggcctgtcttcctcagccaggccccag
ggccagcaagctggctccccctccaaagaagacaggaagcaggcaaacatcaagaggcag
ctgatgaccaacttcatcctgggctcttttgatgactactcctccgacgaggactctgtt
gccggctcatctcgtgagtctaccaggaagggcagccgggccagcttgggggccctgtcc
ctggaggctgctctgaccgcaggtgaagctgagacccgtgtccccactatgaggccgagc
atgtcgggactccacctggtgaagaggggacgggaacacaagaagctggacctgcacaga
gactttacagtggcttctcccgctgagtttgtcacacgctttggcggggatcgggtcatc
gagaaggtgcttattgccaacaacgggatcgccgccgtgaagtgcatgcgctccatccgc
aggtgggcctatgagatgttccgcaacgagcgggccatccggtttgttgtgatggtgacc
cctgaggaccttaaggccaacgcagagtacatcaagatggcggatcagtacgtccccgtc
ccaggagggcctaataacaacaactatgccaacgtggagctgattgtggacattgccaag
agaatccctgtgcaggcggtgtgggctggctggggccatgcttccgaaaaccctaaactt
ccggagctgctgtgcaagaatggagttgctttcttaggccctcccagtgaggccatgtgg
gccttaggagataagatcgcctccaccattgtcgcccagacgctgcaggtcccaaccctg
ccctggagtggaagcggcctgacagtggagtggacagaagatgatctgcagcagggaaaa
ataatcagtgtcccagaagatgtttatgaccagggttgtgtgaaagacgtagatgagggc
ttggaggcagcagaaaaaattggttttccattgatgatcaaagcttctgaaggtggcgga
gggaagggaatccggaaggctgagagtgcggaggacttcccgatccttttcagacaagta
cagagtgagatcccaggctcgcccatctttctcatgaagctggcccagcacgcccgtcac
ctggaagttcagatcctcgccgaccagtatgggaatgctgtgtctctgtttggtcgcgac
tgctccatccagcggcggcatcagaagattgttgaggaagcaccggccaccattgccccg
ctggccatattcgagttcatggagcagtgtgccgtccgcctggccaagaccgtgggctat
gtgagtgcagggacagtggaatacctctacagccaggacggcagcttccacttcttggag
ctgaatcctcgtttgcaggtggaacatccctgcacggaaatgatcgctgacgtcaatctg
ccggctgcccagctacagatcgccatgggcgtgccactgcaccggctgaaggatatccgg
cttctgtacggagagtcgccatggggagtgactcccatttctttcgaaaccccgtcaaac
cctcccctcgcccgaggtcacgtcattgccgccagaatcaccagtgaaaacccagatgag
gggtttaagccgagctccgggactgtccaggaactgaatttccgcagcagcaagaacgtg
tggggttacttcagtgtggctgctactggaggcctgcatgagtttgcggattcccagttt
gggcactgcttctcctggggagagaaccgggaagaggccatttcgaacatggtggtggct
ttgaaggaactgtccatccgaggtgactttaggaccaccgtggaatacctcattaacctc
ctggagaccgagagcttccagaacaatgacatcgacaccgggtggttggactacctcatt
gctgagaaagtgcaggcggagaaaccggatatcatgcttggggtggtatgcggggccttg
aacgtggcggatgcgatgttcagaacgtgcatgacagatttcttacactgcctggaaagg
ggccaggtcctcccagcggattcactactgaacatcgtagatgtggaattaatttacgga
ggcattaagtacattctcaaggtggcccggcagtctctgaccatgttcgttctcatcatg
aatggctgccacatcgagattgatgcccaccggctgaacgatggggggctcctgctctcc
tacaatgggaacagctacaccacctacatgaaggaagaggttgacagttaccgaattacc
atcggcaataagacatgtgtgtttgagaaggagaatgatcctacggtcctgagatccccc
tcggctgggaagctgacacagtacacagtggaggacgggggccacgttgaggctgggagc
agctacgctgagatggaggtgatgaagatgatcatgactctgaacgtgcaggaaagtggc
cgggtgaagtacatcaagcgtccaggggccgtgctggaagcaggctgcgtggtggccagg
ctggagcttgatgacccttctaaggtccacccggctgaaccgttcacaggagaactccct
gcccagcagacactgcccatccttggagagaaactgcaccaggtcttccacagcgtcctg
gaaaacctcaccaacgtcatgagtggcttttgtctgccggagcccatttttagcataaag
ttgaaggagtgggtgcagaagctcatgatgaccctccggcatccgtcactgccgctgctg
gagctgcaggagatcatgaccagcgtggcaggccgcatcccggcccccgtggagaagtca
gtccgcagggtgatggcccagtatgccagcaacatcacctcggtgctgtgccagttcccc
agccagcagatagccaccatcctggactgccacgcggccaccctgcagcggaaggctgac
cgagaggtcttcttcctcaacacccagagcattgtgcagttggtccagagataccgcagc
gggatccgcggctatatgaaaacagtggtgttggatctcctgagaagatacttgcatgtc
gagcaccattttcagcaagcccattacgacaagtgtgtgataaacctcagggagcagttc
aagccagacatgtcccaggtgctggactgcatcttctcccacgcacaggtggccaagaag
aaccagctggtgatcatgctgatcgatgagctgtgtggcccagacccttccctatcggac
gagctgacctccatccttaatgagctcactcagctgagcaaaagcgagcactgcaaagtg
gccctcagagcccggcagatcctgattgcctcccacctcccctcctatgagctgcggcac
aaccaggtggagtccattttcctgtctgccattgacatgtacggccatcagttctgcccc
gagaacctcaagaagttaataatttcagaaacaaccatcttcgacgtcctgcctgctttc
ttctatcacgctaacaaagtcgtgtgcatggcatccttggaggtttacgtgcggaggggc
tacatcgcctatgagttaaacagcctgcagcaccggcagctcccggacggcacctgcgtg
gtagaattccagttcatgctgccctcctcccacccaaaccggatgaccgtgcccatcagc
atcaccaaccctgacctgctgaggcacagcacagagctcttcatggacagcggcttctcc
ccactgtgccagcgcatgggggccatggtagccttcaggagattcgaggacttcaccaga
aattttgatgaagtcatctcttgcttcgccaacgtgcccaaagacacccccctcttcagc
gaggcccgcacctccctgtactccgaggatgactgcaagagcctcagagaagaccccatc
cacattctgaatgtgtccatccagtgtgcagaccacctggaggatgaggcactggtgccg
attttacggacgttcgtacagtccaagaaaaatatccttgtggattacggactccgacga
atcacattcctgattgcccaagagaaagaatttcccaagtttttcacattcagagcaaga
gatgagtttgcagaagatcgcatttaccgtcacttggagcctgccctggccttccaactg
gagctcagccggatgcgtaacttcgatctgaccgccgtgccctgtgccaaccacaagatg
cacctttacctgggtgctgccaaggtgaaggaaggggcggaagtgacggaccataggttc
ttcatccgcgccatcatcaggcactcagacctgattacaaaggaagcctccttcgagtac
ctgcagaacgagggtgagcggctgctcctggaggccatggacgagctggaggtggcgttc
aacaacaccagcgtgcgcaccgactgcaaccacatcttcctcaacttcgtgcccactgtc
atcatggaccccttgaagatcgaggagtccgtgcgctccatggttatgcgctacggcagc
cggttgtggaaactccgcgtgctgcaggctgaagtcaagatcaacatacgccagaccacc
accggcagcgctgttcccatccgcctgttcatcaccaatgagtcgggctactacctggac
atcagcctctacaaagaagtgactgactccagatccggaaatatcatgtttcactccttt
ggcaacaagcaagggccccagcacgggatgctgatcaatactccctacgtcaccaaggat
ctgctccaggccaagcgattccaggcccagtccctgggaactacctacatctatgacttc
ccagaaatattcagacaggctctctttaaactatggggctccccagacaagtatcccaaa
gacatcctgacatacactgaattagtgttggactctcagggccagctggtggagatgaac
cgacttcctggtggaaatgaggtgggcatggtggccttcaaaatgaggtttaagacccag
gagtaccctgaaggacgggacatgatcgtcatcggcaacgatatcacctttcgcatcgga
tcctttggccctggggaggaccttctatacctgcgggcatctgagatggcccgggcagag
ggcattcccaaaatctacgtggcagccaacagtggcgcccgtattggcatggcagaggag
atcaaacacatgttccacgtggcttgggtggacccagaagacccccacaaaggatttaaa
tacctgtacctgactccccaagactacaccagaatcagctccctgaactctgtccactgt
aaacacatcgaggaaggaggagaatccagatacatgatcacggatatcatcgggaaagat
gatggcttgggcgtggagaatctgaggggctcaggcatgattgctggggagtcctctctg
gcttacgaagagatcgtcaccattagcttggtgacctgccgagcccttgggatcggggcc
tacttggtgaggctgggccagcgagtgatccaggtggagaactctcacatcatcctcacg
ggagcaagtgctctcaacaaggtcctgggaagagaggtctacacatccaacaaccagctg
ggtggcgttcagatcatgcattacaatggcgtttcccacatcaccgtgccagatgacttt
gagggggtttataccattctggagtggctgtcctatatgccaaaggataatcacagccct
gtccctatcatcacacccactgaccccattgacagagaaattgaattcctcccatccaga
gctccctacgacccccggtggatgcttgcaggaaggcctcacccaacgctgaagggaacg
tggcagagcggattctttgaccatggcagtttcaaggaaatcatggcaccctgggcgcag
accgtggtgacaggacgagcaaggcttggggggattcccgtgggagtgattgctgtggag
acgcggactgtggaggtggtggtccctgcagaccctgccaacctggattctgaggccaag
ataattcagcaggcagggcaggtgtggttcccagactcagcctacaaaaccgcccaggcc
atcaaggacttcaaccgggagaagttgcccctgatgatctttgccaactggagggggttc
tccggtggcatgaaagacatgtatgatcaggtgctgaagtttggagcctacatcgtggat
ggcctcagacaatacaaacagcccatcctgatctatatcccaccctatgcggagctccgg
ggaggctcctgggtggtcatagatgccaccatcaacccgctgtgcatagaaatgtatgcg
gacaaagagagcagggggggtgttctggagccagaggggacagtggagattaagttccga
aagaaagatctgataaagtccatgagaaggatcgatccagcttacaagaagctcatggaa
cagctaggggaacctgatctctcagacaaggaccgcagggacctggagggccggctgaag
gctcgcgaggacctgctgctccccatctaccaccaggtggcggtgcagttcgccgacttc
cacgacacgcccggccggatgctggagaagggcgtcatatctgacatcctggagtggaag
accgcgcgcaccttcctgtattggcgtctgcgccgcctcctcctggaggaccaggtcaag
caggagatcctgcgggccagcggggagctgagtcacgtgcacatccagtccatgctgcgc
cgctggttcgtggagacggagggggctgtcaaggcctacctgtgggacaacaaccaggtg
gttgtgcagtggctagaacagcactggcaggtggaggacggcccgcgctccaccatccgc
gagaacatcacgtacctgaagcacgactctgtcctcaagaccatccgaggcctggttcaa
gaaaaccccgaggtggccgtggactgtgtgatatacctgagccagcacatcagcccagct
gagcgggcacaggtcatccacctgctgtctaccatggacagcccggcctccacctga

DBGET integrated database retrieval system