KEGG   Macaca mulatta (rhesus monkey): 706924Help
Entry
706924            CDS       T01028                                 

Gene name
AANAT
Definition
aralkylamine N-acetyltransferase (EC:2.3.1.87)
Orthology
K00669  
arylalkylamine N-acetyltransferase [EC:2.3.1.87]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Tryptophan metabolism
Metabolic pathways
Module
Melatonin biosynthesis, tryptophan => serotonin => melatonin
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    706924 (AANAT)
Enzymes [BR:mcc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.87  aralkylamine N-acetyltransferase
     706924 (AANAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
16
AA seq 204 aa AA seqDB search
MSTQSTHPPKPEAPRLPPAISSCQRRHTLPASEFRCLTPEDAVSAFEIEREAFISVLGVC
PLYLDEIRHFLTLCPELSLGWFEEGCLVAFIIGSLWDKDRLMQESLTMHRPGGHIAHLHV
LAVHCAFRQQGRGPILLWRYLHHLGSQPAVHRAALMCEDALVPFYERFGFHAMGPCAITV
GSLSFTELHCSLQGHPFLRRNSGC
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtccacacagagcacccaccccccgaaacccgaggccccgcgtctgccgcctgcgatc
tcgagctgtcagcggcgccacacgctccctgccagcgagtttcgctgcctcaccccggag
gacgccgtcagcgcctttgagatcgagcgtgaagccttcatctccgtcttgggtgtctgc
cccctgtacctggatgagatccggcacttcctgaccctgtgtccggagctgtccctgggc
tggttcgaggagggctgccttgtggccttcatcatcggctcactctgggacaaggacaga
ctcatgcaggagtcactgacgatgcacaggcctgggggccacatagcccacttgcacgtg
ctggccgtgcactgcgccttccggcagcagggcaggggccccatcctgctgtggcgctac
ctgcaccacctgggcagccagccggctgtgcaccgggccgcgctcatgtgcgaggacgcg
ctggtacccttctatgagaggttcggcttccacgccatgggcccctgcgccatcaccgtg
ggctccctcagcttcacggagctccactgctccctgcagggccaccccttcctgcgcagg
aacagcggctgctga

DBGET integrated database retrieval system