KEGG   Macaca mulatta (rhesus monkey): 706930Help
Entry
706930            CDS       T01028                                 

Gene name
USP4
Definition
ubiquitin specific peptidase 4 (proto-oncogene)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     706930 (USP4)
Peptidases [BR:mcc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   706930 (USP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 935 aa AA seqDB search
MAEGGGFGERPDAETQKSELGALMRTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVG
EHNLFPGPIDNSGLFSDPESQTLKEHLIDELDYVLVPTEAWNKLLNWYGCVEGQQPIVRK
VSYVDRPTCSSLSAATIEKEMRKLFNIPAERETRLWNKYMSNTYEQLSKLDNTVQDAGLY
QGQVLVIEPQNEDGTWPRQTLQSKSSTAPSRNFTTSPKSSASPYSSVSASPIANGDSTST
CGMHSSGVSRGGSGFSASYNYQEPPSSHIQPGLCGLGNLGNTCFMNSALQCLSNTAPLTD
YFLKDEYEAEINRDNPLGMKGEIAEAYAELIKQMWSGRDAHVAPRMFKTQVGRFAPQFSG
YQQQDSQELLAFLLDGLHEDLNRVKKKPYLELKDANGRPDAVVAKEAWENHRLRNDSVIV
DTFHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLKKDRVMEVFLVPADPHCRPTQYRVT
VPLMGAVSDLCEALSRLCGIAAENMVVADVYNHRFHKIFQMDEGLNHIMPRDDIFVYQVC
STSVDGSECVTLPVYFRERKSRPSSTSSGSALYGQPLLLSVPKHKLTLESLYQAVCDRIS
RYVKQPLPDDFGSSPLEPGTCNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDELGND
PTKTTQKKIKGQPCPKRLFTFSLVNSYGTADINSLATDGKLLKLNSRSTLAIDWDSETRS
LYYDEQESEAYEKHVSMLQPQKKKKTTVALRDCIELFTTMETLGEHDPWYCPNCKKHQQA
TKKFDLWSLPKILVVHLKRFSYNRYWRDKLDTVVEFPIRGLNMSEFVCNPSARPYVYDLI
AVSNHYGAMGVGHYTAYAKNKLNGKWYYFDDSNVSLASEDQIVTKAAYVLFYQRRDDEFY
KTPSLSSSGSSDGGTRPSSCQQGMGDDEACSMDTN
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggtggaggcttcggtgagcgaccggatgcggagactcagaagtcggagctt
ggagccttaatgaggaccacactccaacgcggcgcgcagtggtatcttattgacagccgg
tggttcaagcagtggaagaagtatgtgggctttgacagctgggacatgtacaatgtgggc
gaacataacctatttcctggcccaatagacaactctgggctattttcagatcctgagagt
cagaccttgaaagaacacttaattgatgaattggactatgtattggtccccaccgaggcc
tggaataaattactaaactggtacggctgtgtagaagggcagcaacccatcgtcagaaaa
gtgagttatgtggatcgtcccacctgctcttcactgtctgcagcaaccattgagaaagag
atgcggaagctgttcaacatccctgcggagcgtgaaacacggctctggaacaaatacatg
agcaacacctacgagcagttgagcaagctagacaacactgtccaggatgctgggctatac
cagggtcaggtgctagtaattgagcctcaaaatgaagatggcacatggcccaggcagacc
ttgcagtcaaaatcaagcactgcgcctagcagaaattttactacctctccaaaatcatca
gcaagtccctattcctcagtgtctgcctctcccattgcaaatggtgatagcactagcacc
tgtgggatgcacagttccggtgtcagcaggggtggatctggcttttctgcttcgtataat
tatcaggagccaccatcctctcatatacaacctgggctctgtggacttggaaacctggga
aacacctgcttcatgaactccgctttgcagtgcttgagcaacactgcaccactgactgac
tactttctcaaagatgagtatgaagccgaaatcaacagagacaaccctctggggatgaaa
ggggaaattgcagaagcctatgcagagctcattaagcagatgtggtctggaagggatgcc
catgtggcacctcgcatgttcaaaactcaagtgggacgttttgctcctcaattttctggc
taccagcaacaagattctcaggagctgttagcctttcttctagatggattgcatgaagat
ctgaaccgagtaaagaagaagccctacttggagctgaaggatgccaatgggcggccagac
gcggtggtggcaaaggaagcctgggagaatcacaggttgaggaatgattctgtgattgtg
gatactttccatggcctcttcaaatctactttggtttgtccagaatgtgctaaggtttcg
gtgacctttgacccattttgctatctaacgctcccactgcccttgaagaaagatcgagtt
atggaggttttcctggttcctgctgaccctcactgcagacctacccagtaccgtgtgact
gtgccgctgatgggggctgtgtccgacctgtgcgaggctctctccaggctgtgtggcatt
gctgcagaaaatatggtggtcgcagatgtatataatcaccgattccacaaaattttccaa
atggatgaaggtttaaaccacatcatgcctcgagatgacattttcgtgtaccaggtctgc
agcacttccgtggatggctcagaatgtgtcacgcttccagtctacttcagggagaggaag
tccaggccatcaagtacttcttctgggtcagcgctatatgggcagccactgctgctttct
gtccccaagcacaagttaacccttgagtctttgtaccaggctgtttgtgatcgtatcagc
cgctatgtgaaacagcctttacctgatgattttggcagctcacccttggagccagggacc
tgcaatggctccaggaacagctgtgaaggagaagatgaggaagaaatggagcatcaggaa
gaaggcaaagagcagctttcagaaacagaaggcagtggggaagatgagctgggaaatgac
cccactaagaccacgcaaaagaagatcaaaggccagccctgcccaaaaaggctttttacc
ttcagtcttgtgaactcctatggaacagctgacataaattcacttgcaactgatggaaaa
ctacttaaactcaactctcgatctacactggccatcgattgggacagtgaaactcggagc
ctttactatgatgagcaagaatctgaggcctacgagaagcatgtgagcatgttgcagcct
cagaagaagaagaagaccacagtggccctgagagactgcatagagctcttcaccaccatg
gagacccttggggagcatgacccctggtactgtcccaactgtaagaagcatcaacaggca
acaaaaaagtttgacctatggtccttgcccaagatcctggtggtccacctcaaacgtttc
tcctacaacagatactggagggataagctcgacacagttgtagaattcccaatcagaggg
ctgaacatgtctgagtttgtctgtaacccgtcagcaaggccttatgtgtacgacctcatt
gccgtgtccaatcattatggagccatgggggttggccactacactgcatatgcgaagaac
aaactgaatgggaaatggtattactttgatgatagcaacgtgtccctggcctctgaggat
cagatagtgactaaagcagcttatgtgctattttaccagcgtcgagatgatgaattttat
aagacgccttcactcagcagttctggttcctctgatggagggacacgaccaagcagctgt
cagcagggcatgggggatgatgaggcttgcagcatggacaccaactga

DBGET integrated database retrieval system