KEGG   Macaca mulatta (rhesus monkey): 706960Help
Entry
706960            CDS       T01028                                 

Definition
(RefSeq) triosephosphate isomerase-like
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00010  Glycolysis / Gluconeogenesis
mcc00051  Fructose and mannose metabolism
mcc00562  Inositol phosphate metabolism
mcc01100  Metabolic pathways
mcc01200  Carbon metabolism
mcc01230  Biosynthesis of amino acids
Module
mcc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mcc_M00002  Glycolysis, core module involving three-carbon compounds
mcc_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    706960
   00051 Fructose and mannose metabolism
    706960
   00562 Inositol phosphate metabolism
    706960
Enzymes [BR:mcc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     706960
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   706960
  Exosomal proteins of bladder cancer cells
   706960
  Exosomal proteins of melanoma cells
   706960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 706960
NCBI-ProteinID: XP_014983647
Position
X
AA seq 248 aa AA seqDB search
MAPSRKFFVVGNWKMNGQKQNLGELIGTLNTAKVPADTEVVRAPPTAYIDFAQQKLDPKT
AVAAQNCYKVTNGDFTGEISPGMIKDCGATWVVLGHSERRHVFEESDELIGHKVAHALSE
GLGVIACIGEKLDEREAGITEKVVFQQTKVIADNVKDWSKAVLAYEPMWAIGTGKTATPQ
QAQEVHEKFRGWLESNVSEALAQSTGIIYGGSVTGATYKELASQPDVDGFLVGGASLKPE
FVDIINAK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggcgccttccaggaagttcttcgttgtggggaactggaagatgaacgggcagaagcag
aatctgggggagctcattggcactctgaacactgccaaggtgccggccgacaccgaggtg
gttcgtgctccccccactgcctatatcgactttgcccagcaaaagctagatcccaagact
gctgtggctgcacagaactgctacaaagtgactaatggggactttactggggagatcagc
cctggcatgatcaaagactgcggagccacgtgggtggtcctggggcactcagagagaagg
catgtctttgaggagtcagatgagctgattgggcataaagtggcccatgctctgtcagag
ggactcggagtaatcgcctgtattggggagaagctagatgaaagggaagctggcatcact
gagaaggttgttttccagcagacaaaggtcatcgcagataatgtgaaagactggagcaag
gccgtcctggcctatgagcccatgtgggccattggtactggcaagactgccacaccccaa
caggcccaggaagtacacgagaaattccgaggatggcttgagtccaacgtctctgaagcc
ctggctcagagcaccggtatcatttatggaggctctgtgactggggcaacctacaaggag
ctggccagccagcctgacgtggatggtttccttgtgggtggtgcttccctcaagcccgaa
ttcgtggacatcatcaatgccaaataa

DBGET integrated database retrieval system