KEGG   Macaca mulatta (rhesus monkey): 706960Help
Entry
706960            CDS       T01028                                 

Gene name
TPI1
Definition
triosephosphate isomerase 1
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    706960 (TPI1)
   01230 Biosynthesis of amino acids
    706960 (TPI1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    706960 (TPI1)
   00051 Fructose and mannose metabolism
    706960 (TPI1)
   00562 Inositol phosphate metabolism
    706960 (TPI1)
Enzymes [BR:mcc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     706960 (TPI1)
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   706960 (TPI1)
  Exosomal proteins of bladder cancer cells
   706960 (TPI1)
  Exosomal proteins of melanoma cells
   706960 (TPI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 275 aa AA seqDB search
MGHWELKSVGENCYTGDTDFQRLGSSAMAPSRKFFVVGNWKMNGQKQNLGELIGTLNTAK
VPADTEVVRAPPTAYIDFAQQKLDPKTAVAAQNCYKVTNGDFTGEISPGMIKDCGATWVV
LGHSERRHVFEESDELIGHKVAHALSEGLGVIACIGEKLDEREAGITEKVVFQQTKVIAD
NVKDWSKAVLAYEPMWAIGTGKTATPQQAQEVHEKFRGWLESNVSEALAQSTGIIYGGSV
TGATYKELASQPDVDGFLVGGASLKPEFVDIINAK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggggcactgggaactgaaatcagttggagaaaattgttacacaggagacaccgacttt
cagcgcctcggctccagcgccatggcgccttccaggaagttcttcgttgtggggaactgg
aagatgaacgggcagaagcagaatctgggggagctcattggcactctgaacactgccaag
gtgccggccgacaccgaggtggttcgtgctccccccactgcctatatcgactttgcccag
caaaagctagatcccaagactgctgtggctgcacagaactgctacaaagtgactaatggg
gactttactggggagatcagccctggcatgatcaaagactgcggagccacgtgggtggtc
ctggggcactcagagagaaggcatgtctttgaggagtcagatgagctgattgggcataaa
gtggcccatgctctgtcagagggactcggagtaatcgcctgtattggggagaagctagat
gaaagggaagctggcatcactgagaaggttgttttccagcagacaaaggtcatcgcagat
aatgtgaaagactggagcaaggccgtcctggcctatgagcccatgtgggccattggtact
ggcaagactgccacaccccaacaggcccaggaagtacacgagaaattccgaggatggctt
gagtccaacgtctctgaagccctggctcagagcaccggtatcatttatggaggctctgtg
actggggcaacctacaaggagctggccagccagcctgacgtggatggtttccttgtgggt
ggtgcttccctcaagcccgaattcgtggacatcatcaatgccaaataa

DBGET integrated database retrieval system