KEGG   Macaca mulatta (rhesus monkey): 706960Help
Entry
706960            CDS       T01028                                 

Definition
(RefSeq) triosephosphate isomerase-like
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    706960
   00051 Fructose and mannose metabolism
    706960
   00562 Inositol phosphate metabolism
    706960
Enzymes [BR:mcc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     706960
Exosome [BR:mcc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   706960
  Exosomal proteins of bladder cancer cells
   706960
  Exosomal proteins of melanoma cells
   706960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
X
AA seq 248 aa AA seqDB search
MAPSRKFFVVGNWKMNGQKQNLGELIGTLNTAKVPADTEVVRAPPTAYIDFAQQKLDPKT
AVAAQNCYKVTNGDFTGEISPGMIKDCGATWVVLGHSERRHVFEESDELIGHKVAHALSE
GLGVIACIGEKLDEREAGITEKVVFQQTKVIADNVKDWSKAVLAYEPMWAIGTGKTATPQ
QAQEVHEKFRGWLESNVSEALAQSTGIIYGGSVTGATYKELASQPDVDGFLVGGASLKPE
FVDIINAK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggcgccttccaggaagttcttcgttgtggggaactggaagatgaacgggcagaagcag
aatctgggggagctcattggcactctgaacactgccaaggtgccggccgacaccgaggtg
gttcgtgctccccccactgcctatatcgactttgcccagcaaaagctagatcccaagact
gctgtggctgcacagaactgctacaaagtgactaatggggactttactggggagatcagc
cctggcatgatcaaagactgcggagccacgtgggtggtcctggggcactcagagagaagg
catgtctttgaggagtcagatgagctgattgggcataaagtggcccatgctctgtcagag
ggactcggagtaatcgcctgtattggggagaagctagatgaaagggaagctggcatcact
gagaaggttgttttccagcagacaaaggtcatcgcagataatgtgaaagactggagcaag
gccgtcctggcctatgagcccatgtgggccattggtactggcaagactgccacaccccaa
caggcccaggaagtacacgagaaattccgaggatggcttgagtccaacgtctctgaagcc
ctggctcagagcaccggtatcatttatggaggctctgtgactggggcaacctacaaggag
ctggccagccagcctgacgtggatggtttccttgtgggtggtgcttccctcaagcccgaa
ttcgtggacatcatcaatgccaaataa

DBGET integrated database retrieval system