KEGG   Macaca mulatta (rhesus monkey): 707110Help
Entry
707110            CDS       T01028                                 

Definition
ubiquitin carboxyl-terminal hydrolase 48-like
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
mcc  Macaca mulatta (rhesus monkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 1032 aa AA seqDB search
MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCKGNPNCLVGIGE
HIWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGATCYVNTFLQVWFLNLELRQALYLC
PSTCSDYVLGDGIQEEKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQ
DAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYVTVCNQCGRESKLLSKFYELE
LNIQGHKQLTDCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRFV
FDRQTGHKKKLNTYIGFSEILDMEPYVEHKGGSYVYELSAVLIHRGVSAYSGHYIAHVKD
PQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCSRNAYMLVYRL
QTQEKPNTAVQVPAFLQELVDRDNSKFEEWCIEMAEMRKQSVDKGKAKHEEVKELYQRLP
AGAEPYEFVSLEWLQKWLDESTPTKPIDNHACLCSHDKLHPDKISIMKRISEYAADIFYS
RYGGGPRLTVKALCKECVVERCRVLRLKNQLNEDYKTVNNLLKAAVKGYVGKAGXYLEWK
QIALEQLDEQDGDAKQSNGKMNGSTLNKDESKEERKEEEELNFNEDILCPHGELCISENE
RRLVSKEAWSKLQQYFPKAPEFPSYKECCSQCKILEREGEENEALHKMIANEQKTSLPNL
FQDKNRPCLSNWPEDTDVLYIVSQFFVEEWRKFVRKPTRCSPVSSVGNSALLCPHGGLMF
TFASMTKEDSKLIALIWPSEWQMIQKLFVVDHVIKIMRIEVGDVNPSETQYISEPKLCPE
CREGLLCQQQRDLREYTQATIYVHKVVDNKKVMKDSAPELNVSSSETEEDKEEAKPDGEK
DPDFNQSNGGTKRQKISHQNYIAYQKQVIRRSMRHRKVRGEKALLVSANQTLKELKIQIM
HAFSVAPFDQNLSIDGKILSDDCATLGTLGVIPESVILLKADEPIADYAAMDDVMQVCMP
EEGFKGTGLLGH
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
atggccccgcggctgcagctggagaaggcggcctggcgctgggcggagacggtgcggccc
gaggaggtgtcgcaggagcacatcgagaccgcttaccgcatctggctggagccctgcatt
cgcggcgtgtgcagacgaaactgcaaaggaaatccgaattgcttggttggtattggtgag
catatttggttaggagaaatagatgaaaatagttttcataacatcgatgatcccaactgt
gagaggagaaaaaagaactcgtttgtgggcctgactaacctcggagccacttgttacgtc
aacacatttcttcaggtgtggtttctcaacttggagcttcggcaggcactctacttatgt
ccaagcacttgtagtgactacgtgttgggagacggcatccaagaagaaaaagattatgag
cctcaaacaatttgtgagcatctccagtacttgtttgccttgttgcaaaacagcaatagg
cgatacattgatccatcgggatttgttaaagccttgggcctagacaccggacaacagcag
gatgctcaagaattttcaaagctctttatgtctctattggaagatactttgtctaaacaa
aagaatccagatgtgcggaacattgttcaacagcagttctgtggagaatatgcctatgta
actgtttgcaaccagtgtggcagagagtcaaagcttttgtcaaaattttacgaactggag
ttaaatatccaaggccacaaacagttaacagattgtatctcggaatttttgaaggaagaa
aaattagaaggagacaatcgctatttttgtgagaactgtcaaagcaaacagaatgcaaca
agaaagattcgacttcttagccttccttgcactctgaacttgcagctaatgcgttttgtc
tttgacaggcaaactggacataagaaaaagctgaatacctacattggcttctcagaaatt
ttggatatggagccttatgtggaacataaaggtgggtcctatgtgtatgaactcagtgca
gtcctcatacacagaggagtgagtgcttattctggccactacatcgcccatgtgaaagat
ccacagtctggtgaatggtataagtttaatgatgaagacatagaaaagatggaggggaag
aaattgcaactagggattgaggaagatctagcagaaccttctaagtctcagacacgtaaa
cccaagtgtggcaaaggaactcactgctctcgaaatgcatatatgttggtttatagactg
caaactcaagaaaagcccaacactgctgttcaagttccagcctttcttcaagagctggta
gatcgggataattccaaatttgaggagtggtgtattgaaatggctgagatgcgtaagcaa
agtgtggataaaggaaaagcaaaacacgaagaggttaaggagctgtaccaaaggttacct
gctggagctgagccctatgagtttgtctctctggaatggctgcaaaagtggttggatgaa
tcaacacctaccaaacctattgataatcacgcttgcctgtgttcccatgacaagcttcac
ccggataaaatatcaattatgaagaggatatctgaatatgcagctgacattttctatagt
agatatggaggaggtccaagactaactgtgaaagccctgtgtaaggaatgtgtagtagaa
cgttgtcgcgtattgcgtctgaagaaccaactaaatgaagattataaaactgttaataat
ctgctgaaagcagcagtaaaggggtatgtaggaaaagcaggataatatttagaatggaaa
caaatagctcttgaacagctagatgagcaagatggtgatgcaaaacaaagcaacggaaag
atgaatggtagcaccttaaataaagatgaatcaaaggaagaaagaaaagaagaggaggaa
ttaaattttaatgaagatattctgtgtccacatggtgagttatgcatatctgaaaatgaa
agaaggcttgtttctaaagaggcttggagcaaactgcagcagtactttccaaaggctcct
gagtttccaagttacaaagagtgctgttcacagtgcaagattttagaaagagaaggggaa
gaaaatgaagccttacataagatgattgcaaacgagcaaaagacttctctcccaaatttg
ttccaggataaaaacagaccgtgtctcagtaactggccagaggatacggatgtcctctac
atcgtgtctcagttctttgtcgaagagtggcggaaatttgttagaaagccgacaagatgc
agccctgtgtcatcagttgggaacagcgctcttttgtgtccccatgggggcctcatgttt
acatttgcttccatgaccaaagaagattctaaacttatagctctcatatggcccagtgag
tggcaaatgatacaaaagctctttgttgtggatcatgtaattaaaatcatgagaattgaa
gtgggagatgtaaacccttcagaaacacagtatatttctgagcctaaactctgtccagaa
tgcagagaaggcttattgtgtcagcagcagagggacctgcgtgaatacactcaagccacc
atctatgtccataaagttgtggataataaaaaggtgatgaaggattcagctccagagctg
aatgtgagtagttctgaaacagaggaggacaaggaagaagctaaaccagatggagaaaaa
gatccagattttaatcaaagcaatggtggaacaaagcggcaaaagatatcccatcaaaat
tatatagcctatcaaaagcaagttattcgccgaagtatgcgacatagaaaagttcgtggt
gagaaagcacttctcgtttctgctaatcagacgttaaaagaattgaaaattcagatcatg
catgcattttcagttgctccttttgaccagaatttgtcgattgatggaaagattttaagt
gatgactgtgccaccctaggcacccttggcgtcattcctgaatctgtcattttattaaag
gctgatgaaccaattgcagattatgctgcaatggatgatgtcatgcaagtttgtatgcca
gaagaagggtttaaaggtactggtcttcttggacattaa

DBGET integrated database retrieval system