KEGG   Macaca mulatta (rhesus monkey): 707293Help
Entry
707293            CDS       T01028                                 

Definition
myosin regulatory light chain 2, atrial isoform-like
Orthology
K12754  
myosin regulatory light chain 7
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:mcc04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:mcc04510]
Cellular Processes; Cell communication; Tight junction [PATH:mcc04530]
Organismal Systems; Immune system; Leukocyte transendothelial migration [PATH:mcc04670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 175 aa AA seqDB search
MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRET
YSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKG
VVNKEEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaggaaggcggggacccgaggcaaagtggcggccaccaagcaggcccaacgt
ggttcttccaacgtcttttccatgtttgaacaagcccagatccaggagttcaaggaagcc
ttcagctgtatcgaccagaatcgtgatggcatcatctgcaaggcagacctgagggagacc
tactcccagctggggaaggtgagtgtcccagaggaggagctggacgccatgctgcaggag
ggcaagggtcccatcaacttcaccgtcttcctcacgctctttggggagaagctcaatggg
acagaccccgaggaagccatcctgagtgccttccgcatgtttgaccccagtggcaaaggg
gtggtgaacaaggaagagtttaagcagcttctcctgacccaggcagacaagttctctcca
gctgaggtggagcagatgttcgccctgacacccatggacctggcggggaacatcgactac
aagtcactgtgctacatcatcacccatggagacgagaaagaggaatga

DBGET integrated database retrieval system