KEGG   Macaca mulatta (rhesus monkey): 707293Help
Entry
707293            CDS       T01028                                 

Gene name
MYL7
Definition
(RefSeq) myosin light chain 7
  KO
K12754  
myosin regulatory light chain 7
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Focal adhesion
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    707293 (MYL7)
  Cell motility
   04810 Regulation of actin cytoskeleton
    707293 (MYL7)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    707293 (MYL7)
Cytoskeleton proteins [BR:mcc04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     707293 (MYL7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 175 aa AA seqDB search
MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRET
YSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKG
VVNKEEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaggaaggcggggacccgaggcaaagtggcggccaccaagcaggcccaacgt
ggttcttccaacgtcttttccatgtttgaacaagcccagatccaggagttcaaggaagcc
ttcagctgtatcgaccagaatcgtgatggcatcatctgcaaggcagacctgagggagacc
tactcccagctggggaaggtgagtgtcccagaggaggagctggacgccatgctgcaggag
ggcaagggtcccatcaacttcaccgtcttcctcacgctctttggggagaagctcaatggg
acagaccccgaggaagccatcctgagtgccttccgcatgtttgaccccagtggcaaaggg
gtggtgaacaaggaagagtttaagcagcttctcctgacccaggcagacaagttctctcca
gctgaggtggagcagatgttcgccctgacacccatggacctggcggggaacatcgactac
aagtcactgtgctacatcatcacccatggagacgagaaagaggaatga

DBGET integrated database retrieval system