KEGG   Macaca mulatta (rhesus monkey): 707293Help
Entry
707293            CDS       T01028                                 

Definition
myosin regulatory light chain 2, atrial isoform-like
Orthology
K12754  
myosin regulatory light chain 7
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    707293
  Cellular commiunity
   04510 Focal adhesion
    707293
   04530 Tight junction
    707293
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    707293
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 175 aa AA seqDB search
MASRKAGTRGKVAATKQAQRGSSNVFSMFEQAQIQEFKEAFSCIDQNRDGIICKADLRET
YSQLGKVSVPEEELDAMLQEGKGPINFTVFLTLFGEKLNGTDPEEAILSAFRMFDPSGKG
VVNKEEFKQLLLTQADKFSPAEVEQMFALTPMDLAGNIDYKSLCYIITHGDEKEE
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaggaaggcggggacccgaggcaaagtggcggccaccaagcaggcccaacgt
ggttcttccaacgtcttttccatgtttgaacaagcccagatccaggagttcaaggaagcc
ttcagctgtatcgaccagaatcgtgatggcatcatctgcaaggcagacctgagggagacc
tactcccagctggggaaggtgagtgtcccagaggaggagctggacgccatgctgcaggag
ggcaagggtcccatcaacttcaccgtcttcctcacgctctttggggagaagctcaatggg
acagaccccgaggaagccatcctgagtgccttccgcatgtttgaccccagtggcaaaggg
gtggtgaacaaggaagagtttaagcagcttctcctgacccaggcagacaagttctctcca
gctgaggtggagcagatgttcgccctgacacccatggacctggcggggaacatcgactac
aagtcactgtgctacatcatcacccatggagacgagaaagaggaatga

DBGET integrated database retrieval system