KEGG   Macaca mulatta (rhesus monkey): 707512Help
Entry
707512            CDS       T01028                                 

Gene name
USP19
Definition
(RefSeq) ubiquitin specific peptidase 19
  KO
K11847  
ubiquitin carboxyl-terminal hydrolase 19 [EC:3.4.19.12]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     707512 (USP19)
Peptidases [BR:mcc01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   707512 (USP19)
Ubiquitin system [BR:mcc04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    707512 (USP19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 1423 aa AA seqDB search
MSGGASATGPRRGPPGLEDATSKKRQKDRANQESKDGDPRKETGSRYVAQAGVELLASGD
PSASASCAAGITGSCHHSRLFFPSLSGSASTPREEQTKEGACEDPHDLLATPPPELLLDW
RQSAEEVIVKLHVGVGPLQLEDVDAAFTDTDCVVRFAGGQQWGGVFYAEIKSSCAKVQTR
KGSLLHLTLPKKVPMLTWPSLLKKPLGTQELVPGLQCQENGQELSPTAPEPGPEPHRAKQ
EARNQKRAQGRGEVGSGAGPGAQAGPSAKRAVHLCRGPEGEGSSDDPGPRGDAPPFVADP
ATQVEADEQLCIPPVNPQTCLLGSEENLALLAGEKAVSPGNDPVSPAMVRSRNSGKDDRA
KEEMAVAADAATLVDGKEPESMVNLAFVKNDSYEKGPDSVVVHVYVKEICRDTSRVLFRE
QDFTLIFQTRDGNFLRLHPGCGPHTIFRWQVKLRNLIEPEQCTFCFTASRIDICLRKRQS
QRWGGLEAPATRGAVGGAKVAVPTGPTPLDSTPPGGAPHPLTGQEEARAMEKDKSKARSE
DTGLESVATRTPMEHVTPKPETHLASPKPTCMVPPMPHSPVSGDSVEEEEEEEKKVCLPG
FTGLVNLGNTCFMNSVIQSLSNTRELRDFFHDRSFEAEINYNNPLGTGGRLAIGFAVLLR
ALWKGTHHAFQPSKLKAIVASKASQFTGYAQHDAQEFMAFLLDGLHEDLNRIQNKPYTET
VDSDGRPDEVVAEEAWQRHKMRNDSFIVDLFQGQYKSKLVCPVCAKVSITFDPFLYLPVP
LPQKQKVLPVFYFAREPHSKPIKFLVSVSKENSTASEVLDSLSQSVRVKPENLRLAEVIK
NRFHRVFLPSHSLDTVSPSDMLLCFELLSPELAKERVVVLEVQQRPQVPSVPISKCAACQ
RKQQSEDEKLKRCTRCYRVGYCNQLCQKTHWPDHKGLCRPENIGYPFLVSVPASRLTYAR
LAQLLEGYARYSVSVFQPPFQPGRMALESQSPGCTTLLSTGSLEAGDSERDPIQPPELQL
VTPMAEGDTGLPRVWAAPDRGPVPSTSGISSEILASGPTEVGSLPAGERVSRPEAAVPGY
QHPSEAMNAHTPQFFIYKIDSSNREQRLEDKGDTPLELGDDCSLALVWRNNERLQEFVLV
ASKELECAEDPGSAGEAARAGHFTLDQCLNLFTRPEVLAPEEAWYCPQCKQHREASKQLL
LWRLPNVLIVQLKRFSFRSFIWRDKINDLVEFPVRNLDLSKFCIGQKEEQLPSYDLYAVI
NHYGGMIGGHYTACARLPNDRSSQRSDVGWRLFDDSTVTTVDESQVVTRYAYVLFYRRRN
SPVERPPRAGHSEHHPDLGPAAEAAASQASRIWQELEAEEEPVPEGPGPLGPWGPQDWVG
PPPRGPTTPDEGCLRYFVLGTVAALVALVLNVFYPLVSQSRWR
NT seq 4272 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcggggccagtgccacaggcccaaggagagggcccccaggactggaggacgca
actagtaagaagaggcagaaggatcgagcaaaccaggagagcaaggatggagatcctagg
aaagagacagggtctcgatatgttgcccaggctggtgttgaacttctggcctcaggtgat
ccttctgcctcagcctcctgcgcagctgggatcacaggctcatgccaccattcccggctg
ttctttccttcattgtcagggtcagcatccactcctcgggaggagcagaccaaagaggga
gcttgtgaagaccctcatgatctcttggctactccccctccagagttgttgctcgattgg
aggcagagtgcagaagaggtgattgtcaagcttcatgtgggagtaggtcccttgcagctg
gaggatgtagatgctgctttcacagatacggactgtgtggtgcggtttgcaggtggtcag
cagtggggtggtgtcttctatgctgagataaaaagctcttgtgctaaagtgcaaacccgc
aagggcagtctcctgcacctgacactgcccaaaaaggtgcctatgctcacgtggccctcc
ctcctgaagaaacctctagggacccaggagctggtgccggggctgcagtgccaggagaat
gggcaggaactgtctcccactgccccggagccaggccctgagccccaccgggctaagcag
gaggcccggaaccagaagcgggcccagggccgtggtgaggtaggctcaggggctggcccc
ggggcccaggcagggcccagcgccaagagggctgtgcatctctgcagagggccagagggg
gaggggtccagcgatgaccctggaccccggggtgatgccccacccttcgtggctgacccg
gccactcaggttgaggctgatgaacagctttgcataccaccggtgaacccccaaacctgc
ctcctgggctcagaggagaatttagcccttttggcaggagagaaagcagtgtctcctggg
aatgacccagtctctccagccatggtccggagcagaaactctgggaaagatgaccgtgcc
aaggaggagatggcagtggcagcagatgctgcaaccttggtggatggtaaagagcccgag
tcgatggtgaacctggcatttgtcaagaatgactcgtatgagaagggcccggattcagtg
gtggtgcacgtgtacgtgaaggagatctgcagggacacctcgagagtactttttcgtgag
caggacttcacactcatcttccagaccagggatggaaacttcctgaggctgcacccaggc
tgtgggccccacaccatcttccgttggcaggtgaagctcaggaatctgattgagccagag
cagtgcaccttctgtttcacggcttctcgcatcgacatctgccttcgtaagaggcagagt
cagcgctgggggggcctggaggccccggctacacgaggtgcagtgggtggtgcaaaggtt
gccgtgccgacaggtccaacccctctggattcaaccccaccaggaggtgctccccacccc
ctgacaggccaggaggaggcccgggctatggagaaggataaatccaaggcacgatctgag
gacacagggctagagagtgtggcaacccgcacacctatggagcatgtaaccccaaagcca
gagacacacctggcgtcgcccaagcctacatgtatggtgcctcccatgccccacagccca
gttagtggagatagcgtggaggaggaggaagaggaagagaagaaagtgtgtctgccaggc
ttcactggccttgtcaatttaggcaacacctgcttcatgaacagcgtcattcagtctctg
tccaacactcgggaactccgggacttcttccatgaccgctcctttgaggctgagatcaac
tacaacaacccactagggactggtgggcgtctggccattggctttgctgtgctgcttcgg
gcgctgtggaagggcacccaccatgccttccagccttccaagttgaaggccattgtggcg
agtaaggccagccagttcacaggctatgcgcagcatgatgcccaggagttcatggctttc
ctgctggatgggctgcacgaggacctgaatcgcattcagaacaagccctacacagagacc
gtggactcagatgggcggcccgatgaggtggtagccgaggaagcatggcagcggcacaag
atgaggaatgactctttcatcgtggacctatttcaggggcagtacaagtcgaagctggtg
tgccctgtgtgtgccaaggtctccatcacttttgacccgtttctttatctgccggtgccc
ttgccacaaaagcaaaaggttctccctgtcttttatttcgcccgagagccccacagcaag
cccattaagttcctagtgagcgtcagcaaggagaactccactgccagtgaagtattggac
tccctctctcaaagcgttcgtgtgaagcctgagaatctgcgtttggcggaggtaattaag
aatcgtttccatcgtgtgttcctgccctcccactcactggacactgtgtccccatctgat
atgctcctctgctttgagctgttatccccagagttggctaaggagcgggtagtggtgcta
gaggtgcaacagcgcccccaggtgcccagcgtccccatctccaagtgtgcagcctgccag
cggaagcaacagtcggaggatgaaaagctgaagcgctgtacccggtgctaccgtgtgggc
tactgcaaccagctctgccagaaaacccactggcctgaccacaagggcctctgccgacct
gagaacattggctaccccttcctggtcagtgtacctgcctcacgcctcacttatgcccgc
cttgctcagctgctagagggctatgcccggtactctgtgagtgtgttccagccacccttt
cagcctggccgcatggccttggagtctcagagccctggctgcaccacactgctctccact
ggctccctggaggctggggacagtgagagggaccccattcagccacctgagctccagctg
gtgacccctatggctgagggggacacagggcttccccgggtgtgggcagcccctgaccgg
ggtcctgtgcccagcaccagtggaatttcttctgagatactggccagtgggcccactgag
gttggctccttgcctgctggcgagagggtgtcccgacccgaagccgctgtgcctgggtac
cagcacccaagtgaagctatgaatgcccacacaccacagttcttcatctataaaattgac
tcatccaaccgagagcagcggctagaggacaaaggagacaccccactggagctgggtgac
gattgtagcctggctctcgtctggaggaacaatgagcgtttgcaggagtttgtgttggta
gcctccaaggagctggaatgtgctgaggatccaggctctgccggtgaggctgcccgggcc
ggccacttcaccctggaccagtgcctcaacctcttcacacggcctgaggtgctggcaccc
gaggaggcctggtactgcccacagtgcaaacagcaccgtgaggcctccaagcagctgttg
ctatggcgcctgccaaatgttctcatcgtgcagctcaagcgcttctcctttcgtagtttt
atctggcgtgacaagatcaatgacttggtggagttccctgttcggaacctggacctgagc
aagttctgcattggtcagaaagaggagcagctgcccagctatgatctgtatgctgtcatc
aaccactatggaggcatgattggtggccactacactgcctgtgcacgcctgcccaatgat
cgtagcagtcagcgcagtgacgtgggctggcgcttgtttgatgacagcacggtgacaacg
gtagacgagagccaggttgtgacgcgttatgcctatgtactcttctaccgccggcggaac
tctcctgtggagaggccccccagggcaggtcactctgagcaccacccagacctaggccct
gcagctgaggctgctgccagccaggcttcccggatttggcaggagctggaggctgaggag
gagccggtgcctgaggggcctgggcccctgggtccctgggggccccaagactgggtgggc
cccccgccacgtggccctaccacaccagatgagggctgcctccggtactttgtcctgggc
accgtggcggctttggtggccctcgtgctcaacgtgttctatcctctggtatcccagagt
cgctggagatga

DBGET integrated database retrieval system