KEGG   Macaca mulatta (rhesus monkey): 707531Help
Entry
707531            CDS       T01028                                 

Gene name
GK3P, GKP3
Definition
glycerol kinase-like
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mcc00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:mcc03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 560 aa AA seqDB search
MAASKKAVLGPLVGAVDQGTSSTRFLVFNSKTAELLSHHQVEIKQEFPREGWVEQDPKEI
LHSVYECIEKTCEKLGQLNIDISNIKAIGVSNQRETTVVWDKITGEPLYNAVAAPVSPGP
SVPVAVVPSGSSVPAAGTSSVWLDLRTQSTVESLSKRIPGNNNFVKSKTGLPLSTYFSAV
KLRWLLDNVRKVQKAVEEKRALFGTIDSWLIWSLTGGVNGGVHCTDVTNASRTMLFNIHS
LEWDKQLCEFFGIPMEILPNVRSSSEIYGLMKAGALEGVPISGCLGDQSAALVGQMCFQI
GQAKNTYGTGCFLLCNTGHKCVFSDHGLLTTVAYKLGRDKPVYYALEGSVAIAGAVIRWL
RDNLGIIKTSEEIEKLAKEVGTSYGCYFVPAFSGLYAPYWEPSARGIICGLTQFTNKCHI
AFAALEAVCFQTREILDAMNRDCGIPLSHLQVDGGMTSNKILMQLQADAAGAAEGVGVWS
LEPEDLSAVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSPESGDPSIFCSLPLG
FFIVSSMVMLIGARYISGIP
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctcaaagaaggcagttttagggccattggtgggggcggtggaccagggcacc
agttcgacgcgctttttggttttcaattcaaaaacagctgaactacttagtcatcatcaa
gtggaaataaaacaagagttcccaagagaaggatgggtggaacaggaccctaaagaaatt
ctacactctgtctatgagtgtatagagaaaacatgtgagaaacttggacagctcaatatt
gatatttccaacataaaagctattggtgtcagcaaccagagggaaaccactgtagtctgg
gacaagataactggagagcctctctacaatgctgtggctgctccagtttctcctggccct
tcagttccagttgccgttgttccctctggctcttcagttccagctgctggtacttcctca
gtgtggcttgatctaagaacccagtctaccgttgagagtcttagtaaaagaattccagga
aataataactttgtcaagtccaagacaggccttccacttagcacttacttcagtgcagtg
aaacttcgttggctccttgacaatgtgagaaaagttcaaaaggccgttgaagaaaaacga
gctctttttgggactattgattcatggcttatttggagtttgacaggaggagtcaatgga
ggtgtccactgtacagatgtaacaaatgcaagtaggactatgcttttcaacattcattct
ttggaatgggataaacagctctgcgaattttttggaattccaatggaaattcttccaaat
gtccggagttcttctgagatctatggcctaatgaaagctggggccttggaaggtgtgcca
atatctgggtgtttaggggaccagtctgctgcattggtgggacaaatgtgcttccagatt
ggacaagccaaaaatacgtatggaacaggatgtttcttactatgtaatacaggccataag
tgtgtattttctgatcatggccttctcaccacagtggcttacaaacttggcagagacaaa
ccagtatattatgctttggaaggttctgtagctatagctggtgctgttattcgctggcta
agagacaatcttggaattataaagacctcagaagaaattgaaaagcttgctaaagaagta
ggtacttcttatggctgctacttcgtcccagcattttcggggttatatgcaccttattgg
gagcccagcgcaagagggataatctgtggactcactcagttcaccaataaatgccatatt
gcttttgctgcattagaagctgtttgtttccaaactcgagagattttggatgccatgaat
cgagactgtggaattccactcagtcatttgcaggtagatggaggaatgaccagcaacaaa
attcttatgcagctacaagcagacgctgcaggggctgcagaaggagtcggcgtatggagt
ctcgaacccgaggatttgtctgccgtcacaatggagcggtttgaacctcagattaatgct
gaggaaagtgaaattcgttattctacatggaagaaagctgtgatgaagtcaatgggttgg
gttacaactcaatctccagaaagtggtgaccctagtatcttctgtagtctgcccttgggc
ttttttatagtgagtagcatggtaatgttaatcggagcaaggtacatctcaggtattcca
taa

DBGET integrated database retrieval system