KEGG   Macaca mulatta (rhesus monkey): 707806Help
Entry
707806            CDS       T01028                                 

Gene name
PFKM
Definition
phosphofructokinase, muscle
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
AMPK signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    707806 (PFKM)
   01230 Biosynthesis of amino acids
    707806 (PFKM)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    707806 (PFKM)
   00030 Pentose phosphate pathway
    707806 (PFKM)
   00051 Fructose and mannose metabolism
    707806 (PFKM)
   00052 Galactose metabolism
    707806 (PFKM)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    707806 (PFKM)
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     707806 (PFKM)
Protein phosphatases and associated proteins [BR:mcc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     707806 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
11
AA seq 851 aa AA seqDB search
MHKDEFHLKFFMCVIQSRQLVRTPQRTAGEASTSSMLIPKPPTKTDTLKSLDTLDDPDTV
RSIPVFKTEWIMTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVF
FVHEGYQGLVDGGDNIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRG
ITNLCVIGGDGSLTGADTFRSEWSDLLGDLQKAGKITDEEATKSSYLNIVGLVGSIDNDF
CGTDMTIGTDSALHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVF
IPECPPDDDWEEHLCRRLSETRTRGSRLNIIIVAEGAIDRNGKPITSEDIKNLVVKRLGY
DTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLM
ECVQVTKDVTKAMEEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVG
APAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGT
KRTLPKKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATV
SNNVPGSDFSVGADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAG
ADAAYIFEEPFTIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGK
GIFDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGC
VLGMRKRALLFQPVTELQGQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEH
ITRKRSGEGAV
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgcataaagacgagtttcatctgaaatttttcatgtgtgtgattcaatctcgccagtta
gtcaggactcctcagagaacagctggggaagcttctacttccagcatgctcataccaaag
ccaccaacaaagacagacaccttgaagagtctagatactttggatgatccagacaccgtg
agaagcatacctgttttcaaaactgagtggatcatgacccatgaagagcaccatgcagcc
aaaaccctggggattggcaaagccatcgccgtcttaacctctggcggagatgcccaaggt
atgaatgctgctgtcagggctgtggttcgagttggtattttcaccggtgcccgtgtcttc
tttgtccatgagggttatcaaggcctggtggatggtggagataacatcaaggaagccacc
tgggagagcgtttcgatgatgcttcagctgggaggcacggtgattggaagtgcccggtgc
aaggactttcgggaacgagaaggacgactccgagctgcctacaacctggtgaagcgtggg
atcaccaatctctgtgtcattgggggtgatggcagcctcactggggctgacaccttccgt
tctgagtggagtgacttgttgggtgacctccagaaagcaggtaagatcacagatgaggag
gctacgaagtccagctacctgaacattgtgggcctggttgggtcaattgacaatgacttc
tgtggcaccgatatgaccattggcactgactctgccctgcaccggatcatagaaattgta
gatgccatcactaccactgcccagagccaccagaggacatttgtgttagaagtgatgggc
cgccactgtggatacctggcccttgtcacctctctgtcctgtggggccgactgggttttt
attcctgaatgtccaccagatgacgactgggaggagcacctttgtcgccgactcagcgag
acaaggactcgtggttctcgtctcaacatcatcattgtggctgagggtgcaattgacagg
aatggaaaaccaatcacctcagaagacatcaagaatctggtggtaaagcgtctgggatat
gacacccgggttactgtcttggggcatgtgcagaggggtgggacgccatcggcctttgac
agaattctgggcagcagaatgggtgtggaagcagtgatggcacttttggaggggacccca
gataccccagcctgtgtagtgagcctctctggtaaccaagctgtgcgcctgcccctcatg
gaatgtgtccaggtgaccaaagatgtgaccaaggccatggaagagaagaaatttgatgaa
gccctgaagttgagaggccggagcttcatgaacaactgggaggtatacaagcttctagct
catgtcagacccccggtatctaagagtggttcgcacacagtggctgtgatgaatgtgggg
gctccggctgcaggcatgaatgctgctgttcgctccactgtgaggattggacttatccag
ggcaaccgagtgctcgttgtccatgatggtttcgagggcctggccaaggggcagatagag
gaagctggctggagctatgttgggggctggactggccaaggtggctctaaacttgggact
aaaaggactctacccaagaagagctttgaacagatcagtgccaatataactaagtttaac
attcagggccttgtcatcattgggggctttgaggcttacacaggtggcctggaactgatg
gagggcaggaagcagtttgatgagctctgcatcccatttgtggtcattcctgctacagtc
tccaacaacgtccctggctcagacttcagcgttggggctgacacagcactcaatactatc
tgcacgacctgtgaccgcatcaagcagtcagcagctggcaccaagcgtcgggtgtttatc
attgagactatgggtggctactgtggctacctggccaccatggctggactggcagctggg
gccgatgctgcctacatttttgaggagcccttcaccattcgagacctgcaggcaaatgtt
gaacacctggtgcaaaagatgaaaacaactgtgaaaaggggcttggtgttaaggaatgaa
aagtgcaatgagaactataccactgacttcattttcaacctgtactctgaggaggggaag
ggcatcttcgacagcaggaagaatgtgcttggtcacatgcagcagggtgggagcccaacc
ccatttgataggaattttgccactaagatgggtgccaaggctatgaactggatgtctggg
aaaatcaaagagagttaccgtaatgggcggatcttcgccaatactccagactcgggctgt
gttctggggatgcgtaagagggctctgctcttccaaccagtgactgagctgcagggccag
acagattttgagcatcgaatccccaaggaacagtggtggctgaaactgaggcccatcctc
aaaatcctagccaagtacgagattgacttggacacttcagaccatgcccacctggagcac
atcacccggaagcggtctggggaaggggctgtttaa

DBGET integrated database retrieval system