KEGG   Macaca mulatta (rhesus monkey): 707892Help
Entry
707892            CDS       T01028                                 

Gene name
LAMB2, LAMC1
Definition
laminin, beta 2 (laminin S)
Orthology
K06243  
laminin, beta 2
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    707892 (LAMB2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    707892 (LAMB2)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    707892 (LAMB2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    707892 (LAMB2)
   05222 Small cell lung cancer
    707892 (LAMB2)
  Infectious diseases
   05146 Amoebiasis
    707892 (LAMB2)
   05145 Toxoplasmosis
    707892 (LAMB2)
Cell adhesion molecules and their ligands [BR:mcc04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     Laminin-11 Extracellular matrix (ECM) components
      707892 (LAMB2)
   VLA-6
      707892 (LAMB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 1798 aa AA seqDB search
MELTSREGGRGQPLPWELRLGLLLSVLAATLAQAPAPDVPGCSRGSCYPATGDLLVGRAD
RLTASSTCGLNGPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPHSHRIQNVVTSFAPQRR
AAWWQSENGIPAVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRYFSY
DCGADFPGVPLAPPRHWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQNLL
KITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVVRGNCFCYGHASECAPAPGAPA
HAEGMVHGACICKHNTRGLNCEQCQDFYHDLPWHPAEDGHSHACRKCECHGHTHSCHFDM
AVYLASGNVSGGVCDGCQHNTAGRHCELCRPFFYRDPTKDLRDPAVCRSCDCDPMGSQDG
GRCDSHDDPALGLVSGQCRCKEHVVGTRCQQCRDGFFGLSISDPLGCRRCQCNARGTVPG
STPCDPNSGSCYCKRLVTGRGCDRCLPGHWGLSHDLLGCRPCDCDVGGALDPQCDEATGQ
CHCRQHMVGRRCEQVQPGYFRPFLDHLTWEAEDTRGQVLDVVERLVTPGETPSWTGSGFV
RLREGQALEFLVASVPKAMDYDLLLRLEPQVPEQWAELELTLQRPGPVPAHSLCGHVLPK
DDRIQGTLQPHTRYMVFPNPVCLEPAISYKLHLKLVRTGGSAQPETPYSGPGLLIDSLVL
LPRALVLEMFSGGNAAALERRATFERYQCHEEGLVPSKTSPSEACAPLLLSLSTLIYNGA
LSCQCNRQGSLSSECNPHGGQCLCKPGVVGRRCDLCAPGYYGFGPTGCQACQCSPEGALS
SLCEKTSGQCPCRTGTFGLHCDRCQRGQWGFPSCRPCVCNGHADECDTHTGACLGCRDHT
GGEHCERCIAGFHGDPQLPYGGQCRPCPCPEGPGSQRHFATSCHRDEYSQKIVCHCRAGY
TGLRCEACAPGHFGDPSRPGGRCQLCECSGNIDLMDPDACDPHTGQCLRCLHHTEGPHCA
HCKPGFHGQAARQSCHRCTCNLLGTNPQQCPSPDQCHCDRSSGQCPCLPNVQGPSCDHCA
PNFWNFTSGHGCHPCACHPRQARGPTCNEFTGQCYCRAGFGGRTCSECQELHWGDAGLQC
RACDCDPRGTDTPQCHRSTGHCSCRPGVSGVRCDQCARGFSGFFPACHPCHACFGDWDRV
VQDLAARTRRLEQRAQELQQTGVLGAFESSFWHMQEKLGIVQGIVGARNTSAASTAQLVE
ATEELRREIGEATEHLTQLEAELTDVQDENFNANHALSGLERDRLALNLTLRQLDQHLDL
LKHSNFLGAYDSIRHAHSQSAEAERCANTSALAVPSPVSNSASARHRTEALMDAQNEDFN
SKHMANQRALRKLSAHTHTLSLTGINELVCGAPGDAPCATSPCGGAGCRDEDGQPRCGGL
NCNGAVATADLALGRARHTQAELQRALAEGGSILSRVAETRRQASEAQQRAQAALDKANA
SRGQVEQANQELRELVQSVKDFLNQEGADPDSIEMVATRVLELSIPASAEQIQHLAGAIA
ERVRSLADVDAILARTVGDVRRAEQLLQDARRARSRAEGEKQKAETVQAALEEAQRAQGV
AQGAIRGAVADTRDTEQTLYQVQERMTGAEQALRSAGERARQLDALLEALKLKWAGNSLA
ASTAEETAGSAQGRAQEAEQLLRGPLGDQYQTVKALAERKAQGVLAAQGRAEQLRDEARD
LLQAAQDKLQRLQELEGTYEENERALEGKAAQLDGLEARMRSVLQAINLQVQIYNTCQ
NT seq 5397 nt NT seq  +upstreamnt  +downstreamnt
atggagctgacctcaagggaaggagggaggggacagcctctgccctgggaacttcgactc
ggcctactgctaagcgtgctggctgccacactggcacaggcccctgccccggatgtgcct
ggctgttcgaggggaagctgctaccccgccacgggcgacctgctggtgggccgagctgac
agactgactgcctcatccacctgtggcctgaatggtccccagccctactgcatcgtcagt
cacttgcaggatgaaaagaagtgcttcctttgcgactcccggcgccccttctctgctaga
gacaacccacacagccatcgcatccagaatgtagtcaccagctttgcaccacagcggcgg
gcagcctggtggcagtcagagaatggtatccctgcagtcaccatccaactggacctggag
gctgagtttcatttcacacacctcattatgaccttcaagacatttcgccctgctgccatg
ctggtggaacgctcagcagactttggccgcacctggcatgtgtaccgatatttctcctat
gactgtggggctgacttcccaggagtcccactagcccctccacggcactgggatgatgta
gtctgtgagtcccgctactcagagattgagccatccactgaaggcgaggtcatctatcgt
gtgttggaccctgccatccctatcccagacccctacagctcacggattcagaacctgttg
aagatcaccaacttacgggtgaacctgactcgtctacacacattgggagacaacctactt
gacccacggagggagatccgagagaagtactactatgccctctatgagctggttgtacgt
ggcaactgcttctgctatggacacgcctcagagtgtgcacctgccccaggggcaccagcc
catgctgagggcatggtgcacggagcttgcatctgcaaacacaacacacgtggcctcaac
tgcgaacagtgtcaggatttctatcatgacctgccctggcatccggctgaggacggccat
agtcatgcctgtaggaagtgtgagtgccatgggcacacccacagctgccacttcgacatg
gctgtatacctggcatctggcaatgtgagtggaggtgtatgtgatggatgtcagcataac
acagctgggcgccactgtgagctctgtcggcccttcttctaccgtgacccaaccaaagac
ctgcgggatccagctgtgtgccgctcctgtgattgtgaccccatgggttctcaagacggc
ggtcgctgtgattcccatgatgaccctgcactgggactggtctcaggccagtgtcgctgc
aaagaacatgtggtgggcactcgctgccaacaatgccgtgatggcttctttgggctcagc
atcagtgaccctctgggctgccggcgatgtcaatgtaatgcacggggcacagtgcctggg
agtactccttgtgaccccaacagtggatcctgttattgcaaacgtctggtgactggacgt
ggatgtgaccgctgcctgcctggccactggggcctgagccacgacctactcggctgccgc
ccctgtgactgcgacgtgggtggtgccttggatccccagtgtgatgaggccacaggtcaa
tgccactgccgccagcacatggtcgggcgacgctgtgagcaggtgcaacctggctacttc
cggcccttcctggaccacctaacttgggaggctgaggacacccgagggcaggtgctcgat
gtggtggagcgcctggttactcctggggaaactccatcctggactggctcaggctttgtg
cggctacgggaaggtcaggccctggagttcctcgtggcctctgtgccgaaggccatggac
tatgatctgctgctgcgcttagaaccccaggtccctgagcaatgggcagagttggaactg
actttgcagcgtccagggcctgtgcctgctcacagcctgtgtgggcatgtgctgcccaag
gatgaccgcatccaagggactctgcaaccacacaccaggtacatggtgtttcccaatcct
gtctgccttgagcctgctatctcctacaagctgcatctgaagctggtacgcacaggggga
agtgcccagcctgagactccctactctggacccggcctgctcattgactcgctggtgctg
ctgccccgtgccctggtgctagagatgtttagtgggggtaatgctgctgccctggagcgc
cgggccacctttgaacgctaccaatgccatgaggagggtctggtgcccagcaagacttct
ccctctgaggcctgcgcgccgctcctcctcagcctgtccaccctcatctacaatggtgcc
ctgtcatgtcagtgcaaccgtcaaggttcactgagttctgagtgcaaccctcatggcggt
cagtgcctgtgcaagcctggagtggttgggcgccgctgtgacctctgtgcccctggctac
tatggctttggccccacaggctgtcaagcctgccagtgcagccccgagggggcgctcagc
agtctctgtgaaaagaccagtgggcaatgtccctgtcgaactggtacctttgggcttcac
tgtgaccgctgccagcgtggccagtggggattccctagctgccggccatgtgtctgcaat
gggcatgcagatgagtgcgacacccacacaggcgcttgcctgggctgccgtgatcacaca
gggggtgagcactgtgaaaggtgcattgctggtttccacggggacccacaactgccatat
gggggccagtgccggccctgtccatgtcctgaaggccctgggagccaacggcactttgct
acttcttgccaccgggatgaatattcccagaagattgtgtgccactgccgggcaggctac
acggggctgcgatgtgaagcttgtgcccctgggcactttggggacccatcaaggccaggt
ggccggtgccaactgtgtgagtgcagtgggaacattgacctaatggatcctgatgcctgt
gacccccacacggggcaatgcctgcgctgtttacaccacacagagggtccacactgtgcc
cactgcaagcctggcttccacgggcaggctgcccgacagagctgtcaccgctgcacctgc
aacctgctgggcacaaatccccagcagtgcccgtctcctgaccagtgccactgtgatcga
agcagtgggcagtgcccatgcctccccaatgtccagggccctagttgtgaccactgtgcc
cccaacttctggaacttcaccagtggccatggttgccatccttgtgcctgccacccaaga
caggccagaggccccacctgcaatgagttcacagggcagtgctactgccgtgccggcttt
ggagggcggacttgttctgagtgccaagagctccactggggagacgctgggttgcagtgt
cgtgcctgtgactgtgaccctcgtggaacagatacacctcagtgtcaccgctccacaggt
cactgcagctgccgcccaggcgtgtctggtgtgcgctgtgaccagtgtgcccgtggcttc
tcaggattctttcctgcctgccatccctgccatgcatgcttcggggattgggaccgagtg
gtgcaggacttggctgcccgcacacggcgcctagagcagcgggcacaggagttgcagcag
acgggtgtgctgggtgcctttgagagcagcttctggcatatgcaggagaagctgggcatt
gtgcagggcatcgtaggtgcccgcaacacctcagccgcctccactgcacagcttgtggag
gccacagaggagctgcggcgtgaaattggggaggccactgagcacctgactcaactggaa
gcagagttgacagatgtgcaggatgagaacttcaatgccaaccatgcactaagtggtctg
gagcgagacaggcttgcacttaatctcacactgcggcagctggaccagcatcttgacttg
ctcaaacattcaaacttcctgggtgcctatgacagcatccggcatgcccatagccagtct
gcagaggcagaacgttgtgccaacacctcggccctggcagtacctagccctgtgagcaac
tcggcaagtgctcggcatcggacagaggcactgatggatgcccagaatgaggacttcaac
agcaaacacatggccaaccagcgggccctgcgcaagctctctgcccatacccacaccctg
agcctgacaggcataaacgagctggtgtgtggggcaccaggggatgcaccctgtgctaca
agcccttgtgggggtgccggctgtcgagatgaggatgggcagccgcgctgtgggggcctc
aactgcaatggggcagtggctacagcagacctagcactgggccgggcccggcacacacag
gcagagctgcagcgggcactggcagaaggtggtagcatcctcagcagagtggctgagact
cgtcggcaggcaagcgaggcacagcagcgggcccaggcagccctggacaaggctaatgct
tccaggggacaggtggaacaggccaaccaggaacttcgagaacttgtccagagtgtgaag
gacttcctcaaccaggaaggggctgatcctgatagcattgagatggtggccacacgggtg
ctagagctctccatcccagcttcagctgagcagatccagcacctggcgggcgcaattgca
gagcgagtccggagcctggcggatgtggacgcgatcctggcacgtactgtaggagatgtg
cgtcgtgccgagcagttattgcaggatgcacggcgggcaaggagccgggctgagggtgag
aaacagaaggcggagacagtacaggcagcactggaggaggcccagcgggcacagggtgtt
gcccagggtgccatccggggggcagtggctgacacacgggacacagagcagaccctatac
caggtacaggagaggatgacaggtgcagagcaggcactgagatctgcaggtgaaagggct
cggcagttggatgctctcctggaggctctgaagttgaaatgggcgggaaatagtctggca
gcctctacagcagaagaaacggcaggcagtgcccagggtcgtgcccaggaggctgagcag
ctgctacggggtcctctgggtgatcagtaccagacggtgaaggccctggctgagcgcaag
gcccagggtgtgctagctgcacagggaagggcagagcaactgcgggatgaggctcgggac
ctgttgcaggctgctcaggacaagctgcagcggctacaggaactggaaggcacctatgag
gagaatgagcgggcactggagggtaaggcagcccagctggacgggctggaggccaggatg
cgcagcgtgcttcaagccatcaacttgcaggtgcagatctacaacacctgccagtga

DBGET integrated database retrieval system