KEGG   Macaca mulatta (rhesus monkey): 707978Help
Entry
707978            CDS       T01028                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase 6
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00230  Purine metabolism
mcc01522  Endocrine resistance
mcc04015  Rap1 signaling pathway
mcc04022  cGMP-PKG signaling pathway
mcc04024  cAMP signaling pathway
mcc04062  Chemokine signaling pathway
mcc04072  Phospholipase D signaling pathway
mcc04114  Oocyte meiosis
mcc04211  Longevity regulating pathway
mcc04213  Longevity regulating pathway - multiple species
mcc04261  Adrenergic signaling in cardiomyocytes
mcc04270  Vascular smooth muscle contraction
mcc04371  Apelin signaling pathway
mcc04540  Gap junction
mcc04611  Platelet activation
mcc04713  Circadian entrainment
mcc04714  Thermogenesis
mcc04723  Retrograde endocannabinoid signaling
mcc04724  Glutamatergic synapse
mcc04725  Cholinergic synapse
mcc04727  GABAergic synapse
mcc04742  Taste transduction
mcc04750  Inflammatory mediator regulation of TRP channels
mcc04911  Insulin secretion
mcc04912  GnRH signaling pathway
mcc04913  Ovarian steroidogenesis
mcc04914  Progesterone-mediated oocyte maturation
mcc04915  Estrogen signaling pathway
mcc04916  Melanogenesis
mcc04918  Thyroid hormone synthesis
mcc04921  Oxytocin signaling pathway
mcc04923  Regulation of lipolysis in adipocytes
mcc04924  Renin secretion
mcc04925  Aldosterone synthesis and secretion
mcc04926  Relaxin signaling pathway
mcc04927  Cortisol synthesis and secretion
mcc04928  Parathyroid hormone synthesis, secretion and action
mcc04934  Cushing's syndrome
mcc04961  Endocrine and other factor-regulated calcium reabsorption
mcc04962  Vasopressin-regulated water reabsorption
mcc04970  Salivary secretion
mcc04971  Gastric acid secretion
mcc04972  Pancreatic secretion
mcc04976  Bile secretion
mcc05032  Morphine addiction
mcc05166  HTLV-I infection
mcc05200  Pathways in cancer
mcc05414  Dilated cardiomyopathy (DCM)
Module
mcc_M00695  cAMP signaling
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    707978 (ADCY6)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    707978 (ADCY6)
   04371 Apelin signaling pathway
    707978 (ADCY6)
   04072 Phospholipase D signaling pathway
    707978 (ADCY6)
   04024 cAMP signaling pathway
    707978 (ADCY6)
   04022 cGMP - PKG signaling pathway
    707978 (ADCY6)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    707978 (ADCY6)
  Cellular community - eukaryotes
   04540 Gap junction
    707978 (ADCY6)
 Organismal Systems
  Immune system
   04611 Platelet activation
    707978 (ADCY6)
   04062 Chemokine signaling pathway
    707978 (ADCY6)
  Endocrine system
   04911 Insulin secretion
    707978 (ADCY6)
   04923 Regulation of lipolysis in adipocyte
    707978 (ADCY6)
   04912 GnRH signaling pathway
    707978 (ADCY6)
   04913 Ovarian Steroidogenesis
    707978 (ADCY6)
   04915 Estrogen signaling pathway
    707978 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    707978 (ADCY6)
   04921 Oxytocin signaling pathway
    707978 (ADCY6)
   04926 Relaxin signaling pathway
    707978 (ADCY6)
   04918 Thyroid hormone synthesis
    707978 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    707978 (ADCY6)
   04916 Melanogenesis
    707978 (ADCY6)
   04924 Renin secretion
    707978 (ADCY6)
   04925 Aldosterone synthesis and secretion
    707978 (ADCY6)
   04927 Cortisol synthesis and secretion
    707978 (ADCY6)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    707978 (ADCY6)
   04270 Vascular smooth muscle contraction
    707978 (ADCY6)
  Digestive system
   04970 Salivary secretion
    707978 (ADCY6)
   04971 Gastric acid secretion
    707978 (ADCY6)
   04972 Pancreatic secretion
    707978 (ADCY6)
   04976 Bile secretion
    707978 (ADCY6)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    707978 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    707978 (ADCY6)
  Nervous system
   04724 Glutamatergic synapse
    707978 (ADCY6)
   04727 GABAergic synapse
    707978 (ADCY6)
   04725 Cholinergic synapse
    707978 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    707978 (ADCY6)
  Sensory system
   04742 Taste transduction
    707978 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    707978 (ADCY6)
  Aging
   04211 Longevity regulating pathway - mammal
    707978 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    707978 (ADCY6)
  Environmental adaptation
   04713 Circadian entrainment
    707978 (ADCY6)
   04714 Thermogenesis
    707978 (ADCY6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    707978 (ADCY6)
  Substance dependence
   05032 Morphine addiction
    707978 (ADCY6)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    707978 (ADCY6)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    707978 (ADCY6)
  Infectious diseases
   05166 HTLV-I infection
    707978 (ADCY6)
  Drug resistance
   01522 Endocrine resistance
    707978 (ADCY6)
Enzymes [BR:mcc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     707978 (ADCY6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AC_N Guanylate_cyc DUF1053 DUF2339 HNOBA Shisa
Motif
Other DBs
NCBI-GeneID: 707978
NCBI-ProteinID: XP_015007072
Ensembl: ENSMMUG00000006253
UniProt: F7H582
Position
11
AA seq 1168 aa AA seqDB search
MSWFSGLLVPKVDERKTAWGERNGQKRSRRCGTRAGGFCTPRYMSCLRDAEPPSPTPAGP
PRCPWQDDAFIRRGGPGKGKELGLRAVALGFEDTEVTTTVGGTAEVAPDAVPRSGRSCWR
RLVQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLTAVLLAFHAAPTRPQPAY
VALLACAAALFLGLMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAADPRSPSAGLW
CPVFFVYIAYTLLPIRMRAAVLSGLGLSTLHLILAWQLNRGDAFLWKQLGANVLLFLCTN
VIGICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINT
KKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHC
LRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRV
HCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNA
YLKEQHIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLMPRWVPDRAFSRTKDSKAFR
QMGIDDSSKDNRGTQDALNPEDEVDEFLSRAIDARSIDQLRKDHVRRFLLTFQREDLEKK
YSRKVDPRFGAYVACALLVFCFICFIQLLIFPHSILMLGIYASIFLLLLVTVLICAVYSC
GSLFPKALQRLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMFTCNHTPMRTCAARMLNLT
PADITACHLQQLNYSLGLDAPLCEGTTPTCSFPEYFIGSVLLSLLASSVFLHISSIGKLA
MVFVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKYMTPV
ILLVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHF
LARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIIS
EERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNN
FQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKG
YQLECRGVVKVKGKGEMTTYFLNGGPSS
NT seq 3507 nt NT seq  +upstreamnt  +downstreamnt
atgtcatggtttagtggcctcctggtccctaaagtggatgaacggaaaacagcctggggt
gaacgcaatgggcagaagcgttcacggcgctgtggcactcgggcaggtggcttctgcacg
ccccgctatatgagctgcctccgggatgcagagccacccagccccacccctgcgggcccc
cctcggtgcccctggcaggatgacgccttcatccggaggggcggcccgggcaagggcaag
gagctggggctgcgggcagtggccctgggcttcgaggacacagaggtgacaacgacagtg
ggcgggacagctgaggtggcgcccgacgcggtgcccaggagtgggcgatcctgctggcgc
cgtctggtgcaggtgttccagtcgaagcagttccgttcggccaagctggagcgcctgtac
cagcggtacttcttccagatgaaccagagcagcctgacgctgctgatggcggtgctggtg
ctgctcacggcggtgctgctggctttccacgcggcgcccacccgccctcagcctgcctat
gtggccctgctggcctgcgccgccgccctgttcctggggctcatggtggtgtgtaaccgg
catagcttccgccaggactccatgtgggtggtgagctacgtggtgctgggcatcctggcg
gcagtgcaggtcgggggcgccctcgcagcagacccacgcagcccctctgcgggcctctgg
tgccctgtgttcttcgtctacatcgcctacacgctcctccccatccgcatgcgggctgcg
gtcctcagcggcctgggcctctccaccctgcatttgatcttggcctggcaacttaaccgt
ggtgatgccttcctctggaagcagctcggtgccaatgtgctgctgttcctctgcaccaac
gtcattggcatctgcacacactatccagcagaggtatctcagcgccaggcctttcaggag
acccgcggttacatccaggcccggctccacctgcagcatgagaatcggcagcaggagcgg
ctgctgctgtcggtgttgccccagcatgttgccatggagatgaaagaagacatcaacaca
aaaaaagaagacatgatgttccacaaaatctacatacagaagcatgacaatgtcagcatc
ctgtttgcagacattgagggcttcaccagcctggcatcccagtgcactgcacaggagctg
gtcatgaccctgaatgagctctttgcccggtttgacaagctggctgcggagaatcactgc
ctgaggatcaagatcttgggggactgttactactgtgtgtcagggctgccggaggcccgg
gccgaccatgcccactgctgtgtggagatgggggtagacatgattgaggccatctcgctg
gtacgtgaggtgacaggtgtgaatgtgaacatgcgcgtgggcattcacagcgggcgtgtg
cactgcggcgtccttggcttgcggaaatggcagttcgatgtgtggtccaatgatgtgacc
ctggccaaccacatggaggcaggaggccgggctggccgcatccacatcactcgggcaaca
ctgcagtacctgaatggggactacgaggtggagccgggccgtggtggcgagcgcaacgca
tacctcaaggagcagcacattgagactttcctcatcctgggcgccagccagaaacggaaa
gaggagaaggccatgctggccaagctgcagcggactcgggccaactccatggaagggctg
atgccgcgctgggtgcctgatcgtgccttctcccggaccaaggactccaaggccttccgc
cagatgggcattgatgattccagcaaagacaaccggggcacccaagatgccctgaaccct
gaggatgaggtggatgagttcctgagccgtgccatcgatgcccgcagcattgatcagctg
cggaaggaccatgtgcgccggtttctgctcaccttccagagagaggatcttgagaagaag
tactcccggaaggtggatccccgcttcggagcctacgttgcctgtgccctgttggtcttc
tgtttcatctgcttcatccagcttctcatcttcccacactccatcctgatgcttgggatc
tatgccagcatcttcctgctgctgctggtcaccgtgctgatctgtgccgtgtactcctgt
ggttctctgttccctaaggccctgcaacgtctgtcccgcagcatcgttcgctcacgggca
catagcaccgcagttggcatcttttccgtcctgcttgtctttacttctgccattgccaac
atgttcacctgtaatcacacccctatgcggacctgtgcagcccggatgctgaatttaaca
cctgctgacatcactgcctgccacctgcagcagctcaattactctctgggcctggatgct
cccctgtgtgagggcaccacgcccacctgcagcttccctgagtacttcatcgggagcgtg
ctgctgagtctcttggccagctctgtcttcctgcacatcagcagcatcgggaagttggcc
atggtctttgtcttggggctcatctatttggtgctgcttctgctgggtcccccagccacc
atctttgacaactatgacctactgcttggcgtccatggcttggcttcttccaatgagacc
tttgatgggctggactgtccagctgcagggagggtggccctcaaatatatgacccctgtg
attctgctggtgtttgcgctggcgctgtatctgcatgctcagcaggtggagtcgactgcc
cgcctagacttcctctggaaactacaggcaacaggggagaaggaggagatggaggagcta
caggcatacaaccggaggctgctgcataacattctgcccaaggacgtggccgcccacttc
ctggcccgggagcgccgcaatgatgaactctactatcagtcgtgtgagtgtgtggctgtt
atgtttgcctccattgccaacttctctgagttctatgtggagctggaggcaaacaatgag
ggtgtcgagtgcctgcggctgctcaacgagatcatcgctgactttgatgagatcatcagc
gaggagcggttccggcagctggaaaagatcaagacaattggtagcacctacatggctgcc
tcagggctgaacgccagcacctacgatcaggtgggccgctcccacatcactgccctggct
gactatgccatgcggctcatggagcagatgaagcacatcaatgagcactccttcaacaat
ttccagatgaagattgggctgaacatgggcccagtcgtggcaggtgtcatcggggctcgg
aagccgcagtatgacatctgggggaacacagtgaatgtctctagtcgtatggacagcacg
ggggtccccgaccgaatccaggtgaccacggacctgtaccaggttctagctgccaagggc
taccagctggagtgtcgaggggtggtcaaggtgaagggcaagggggagatgaccacctac
ttcctcaatgggggccccagcagttag

DBGET integrated database retrieval system