KEGG   Macaca mulatta (rhesus monkey): 708113Help
Entry
708113            CDS       T01028                                 

Gene name
ST6GAL1
Definition
ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 (EC:2.4.99.1)
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    708113 (ST6GAL1)
   00514 Other types of O-glycan biosynthesis
    708113 (ST6GAL1)
Enzymes [BR:mcc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     708113 (ST6GAL1)
Glycosyltransferases [BR:mcc01003]
 Terminal extension
  Sialyltransferase
   708113 (ST6GAL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 406 aa AA seqDB search
MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDS
QSVSSSSTQDPHRGRQALGSLRDIPKAKPEAFFQVWNKDSSSKNLIPRLQKIWKNYLSMN
KYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEATDFPFNTSEWEGYLPKDNIRTKAGP
WGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTE
KRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKSYRKLHPDQPFYILKPQM
PWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFF
DSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgattcacaccaacttgaagaagaagttcagctgctgtgtcctggtctttcttctgttt
gcagtcatctgtgtgtggaaggaaaagaagaaagggagttactatgattcctttaaattg
caaaccaaggaattccaggtgttgaagagtctggggaaattggccatggggtctgattcc
cagtctgtatcctcaagcagcacccaggacccccacaggggccgccaggccctcggcagt
ctcagagacatacccaaggccaaaccagaggccttcttccaggtgtggaacaaggacagc
tcttccaaaaaccttatccctaggctgcaaaagatctggaagaattacctaagcatgaac
aagtacaaagtgtcctacaaggggccaggaccaggcatcaagttcagtgcagaggccctg
cgctgccacctccgggaccacgtgaatgtatccatggtagaggccacagattttcccttc
aatacctctgaatgggagggttatctgcccaaggacaatattaggaccaaggctgggcct
tggggcaggtgtgctgttgtgtcgtcagcgggatctctgaagtcctcccaactaggcaga
gaaatcgatgatcatgacgcagtcctaaggtttaatggggcacccacagccaacttccag
caagatgtgggcacaaaaactaccattcgcctgatgaactctcagttggttaccacagag
aagcgcttcctcaaagacagtttgtacaatgaaggaatcctaatcgtatgggacccatct
gtataccattcagatatcccaaagtggtaccagaatccggattataatttctttaataac
tacaagagttatcgtaagctgcaccccgatcagcccttttacatcctcaagccccagatg
ccttgggagctgtgggacattcttcaagaaatctccccagaagagattcagccaaacccc
ccatcctctgggatgcttggtatcatcatcatgatgaccctatgtgaccaggtggatatt
tatgagttcctcccatccaagcgcaagaccgacgtgtgctactactaccagaagttcttc
gatagtgcctgcacgatgggcgcctaccacccactgctctatgagaagaatttggtgaag
catctcaaccagggcacagatgaggacatctacctgcttggaaaagccacactgcctggc
ttccggaccattcactgctaa

DBGET integrated database retrieval system