KEGG   Macaca mulatta (rhesus monkey): 708151Help
Entry
708151            CDS       T01028                                 

Gene name
PTPN5
Definition
protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) (EC:3.1.3.48)
Orthology
K18018  
tyrosine-protein phosphatase non-receptor type 5 [EC:3.1.3.48]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    708151 (PTPN5)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     708151 (PTPN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 565 aa AA seqDB search
MNYEGARSERENHAADDFEGGALDMCCSERLPGLPQPIVMEALDEAEGLQDSQREMPPPP
PPSPPSDPAQKPPPRGAGSHSLTVRSSLCLFAASQFLLACGVLWFCGYGHVWAQNATNLV
SSLLTLLKQLGPTAWLDSGTWGVPSLLLVSLSMGLVLVTTLVWHLLRTPPEPPTPLPPED
RRQSVSRQPSFTYSEWMEEKVEDDFLDLDPVPETPVFDCVMDIKPEADPASLTVKSMGLQ
ERRGSNVSLTLDMCTPGCNEEGFGYLMSPREESAREYLLSASRVLQAEELHEKALDPFLL
QAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPLSSYINANYIR
GYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVVYD
DVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEE
ATQQEGPHCAPIIVHCSAGIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQ
TCEQYQFVHHVMSLYEKQLSHQSPE
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgaattatgagggagccaggagtgagagagagaaccacgctgctgatgacttcgaggga
ggagccctggacatgtgctgcagtgagaggctaccgggtctcccccagccgatagtgatg
gaggccctggacgaggccgaagggctccaggactcgcagagagagatgccgccaccccct
cctccctcgccgccctcagatccagctcagaagccaccgcctcgaggtgccgggagccac
tccctcactgtcaggagcagcctgtgcctgtttgctgcctcacagttcctgcttgcctgc
ggggtgctttggttctgcggctatggccacgtctgggcacagaacgccacaaacctcgtc
tcctctttgctgacgctcctgaaacagctgggacccacggcctggcttgactctgggacc
tggggagtccccagtctgctgctggtctctctgtccatgggcctggtcctcgttaccacg
ctggtgtggcacctcctgaggacacccccagagccacccaccccactgccccctgaggac
agacgccagtcagtgagccgccagccctccttcacctactctgagtggatggaggagaaa
gttgaggatgacttcctggacctggacccggtgcccgagactcctgtgtttgattgtgtg
atggacatcaagcctgaggccgaccccgcctcgctcaccgtcaagtccatgggtctgcag
gagaggaggggctccaatgtctcgctgaccctggacatgtgcactccgggctgcaacgag
gagggctttggctacctcatgtccccacgtgaggagtccgcccgcgagtacctgctcagc
gcctcacgtgtcctccaagcagaagagcttcacgaaaaggccctggaccctttcctgctg
caggcggaattctttgaaatccccatgaacttcgtggatcccaaagagtacgacatccct
gggctggtgcggaagaaccggtacaaaaccatacttcccaaccctcacagcagagtgtgt
ctgacctcaccagaccctgacgaccccctgagttcctacatcaatgccaactacatccgg
ggctacggtggggaggagaaggtgtacatcgccactcagggacccatcgtcagcacggtc
gccgacttctggcgcatggtgtggcaggagcacacgcccatcattgtcatgatcaccaac
atcgaggagatgaacgagaaatgcaccgagtattggccagaggagcaggtggtgtacgac
gatgttgagatcactgtgcagaaagtcattcacacggaggattaccggctgcgactcatc
tccctcaagagtgggactgaggagcgaggcctgaagcattactggttcacatcctggccc
gaccagaagaccccagaccgggcccccccactcctgcacctggtgcgggaggtggaggag
gcaacccagcaggaggggccccactgtgcccccatcatcgtccactgcagtgcagggatt
gggaggaccggctgcttcattgccaccagcatctgctgccagcagctgcggcaggagggt
gtggtggacatcctgaagaccacgtgccagctccgtcaggacaggggcggcatgatccag
acatgcgagcagtaccagtttgtgcaccacgtcatgagcctctacgaaaagcagctgtcc
caccagtccccagaatga

DBGET integrated database retrieval system